(data stored in ACNUC7421 zone)

EMBL: BA000007.PRPR

BA000007.PRPR        Location/Qualifiers
FT   CDS_pept        complement(403557..405143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ECs_0384"
FT                   /product="propionate catabolism operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33807"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33807"
FT                   /db_xref="GOA:Q8X698"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X698"
FT                   /protein_id="BAB33807.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIRKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSAPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKIPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
     atggcacatc caccacggct gaatgacgac aaaccggtta tctggacggt atctgtaacg        60
     cgcttattcg agctgtttcg cgatatcagc ctcgagtttg atcacctggc gaacattacc       120
     cctattcagc ttggctttga aaaagcagtg acctacatcc gcaagaaact ggcaaacgaa       180
     cgctgtgacg ccatcatcgc cgctggctct aacggcgcgt acctgaaaag ccgcctgtca       240
     gtgccagtta ttttgattaa accgagcggc tacgatgtgt tacaggcact ggcaaaagcc       300
     ggaaaactca cctcttctat cggcgttgtc acttatcagg aaactattcc ggcactggtg       360
     gcgtttcaaa aaacctttaa tttgcgcctc gatcaacgta gctacattac cgaagaagac       420
     gcacgcgggc agattaacga gctaaaagct aacggcaccg aagcggtggt cggcgcgggg       480
     ctgattaccg atctggcaga agaagccgga atgaccggaa tttttatcta ttccgccgcc       540
     accgtgcgcc aggcgttcag cgatgcgctg gatatgacgc gcatgtcgtt acgccataac       600
     actcacgatg ccacccgcaa cgccctgcgt actcgttacg tgctgggcga tatgctcggt       660
     caatcaccac agatggagca ggtgcggcag actattttgc tgtatgcccg ctccagtgcg       720
     gcggtgttga ttgaggggga aacggggacg ggcaaagagc tggcggccca ggcaattcat       780
     cgggaatatt ttgcccgcca cgatgcgcga cagggcaaaa agtcgcatcc gtttgttgcc       840
     gtcaactgcg gggcgattgc cgaatcgctg ctggaagcgg agctgtttgg ctatgaggaa       900
     ggggcgttta ccggctcgcg acgcggaggt cgcgccgggc tgttcgaaat tgcccacggt       960
     ggcacgctgt ttctggatga gattggcgaa atgccgctac ctttgcagac tcgcctgtta      1020
     cgggtgctgg aagaaaaaga ggtcacccgc gtcggcgggc atcagcctgt tccggtagat      1080
     gtacgggtca ttagcgccac tcactgcaat ctggaagaag atatgcggca agggcagttt      1140
     cgccgtgatc tgttttatcg gctgagtatt ttgcgtctgc aattgccacc actgcgcgag      1200
     cgggtggcag atattcttcc gctggcggaa agctttttga aagtgtctct ggcggcgctc      1260
     tccgccccat tttctgccgc attacgccag ggattacagg caagcgaaac cgtgctggtg      1320
     cactacgact ggccaggtaa tattcgtgaa ctgcgcaata tgatggagcg actggcgcta      1380
     tttttaagtg tggaaccgac gccggattta acgccgcagt ttttgcagct gctactgccg      1440
     gaactggcgc gcgagtcggc gaaaattccc gctccacgct tgctgacacc acaacaggca      1500
     ctggagaaat ttaatggcga taaaacagca gcggcgaatt atttaggcat cagccggacg      1560
     acgttctggc ggcggctgaa aagctga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page