(data stored in ACNUC7421 zone)

EMBL: BA000007.PSIF

BA000007.PSIF        Location/Qualifiers
FT   CDS_pept        463061..463381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECs_0434"
FT                   /product="phosphate starvation-inducible protein PsiF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33857"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33857"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEB3"
FT                   /protein_id="BAB33857.2"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     atgaaaatta cattactggt taccttgctt ttcggtctgg tttttttaac caccgtcggc        60
     gctgccgaga gaaccttaac cccacaacaa cagcgtatga cctcctgtaa tcagcaggcg       120
     acggcacagg cgttgaaagg ggatgctcgt aagacctaca tgagtgattg cctgaagaac       180
     agcaagtctg cgcctggtga aaaaagtttg acgccacagc agcaaaagat gcgcgaatgt       240
     aataatcaag caacgcaaca atcactgaaa ggtgatgatc gtaataagtt tatgagcgcc       300
     tgcctcaaga aagccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page