(data stored in ACNUC7421 zone)

EMBL: BA000007.RCLC

BA000007.RCLC        Location/Qualifiers
FT   CDS_pept        complement(360441..361034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclC"
FT                   /locus_tag="ECs_0340"
FT                   /product="reactive chlorine species stress resistance inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33762"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33762"
FT                   /db_xref="GOA:Q8X6F8"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6F8"
FT                   /protein_id="BAB33762.1"
FT                   /translation="MEKYLHLLSRGDKIGLALIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQSANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQGSNESSSTLKTEY"
     atggaaaaat acctgcacct gttaagtcgg ggagataaaa ttggcctggc attgattcgt        60
     ctgagtattg cgattgtttt tatgtggatt gggttattaa agtttgtccc ttacgaggca       120
     gacagcatta caccattcgt cgcaaacagt ccactaatgt cgttctttta tgaacacccg       180
     gaagactata aacagtatct gactcacgaa ggcgaataca aaccagaagc aagggcatgg       240
     caatcggcca ataataccta tggtttttcc aacggtcttg gcgtcgtgga ggtgattatt       300
     gctctgctgg ttttggctaa tcctgtcaat cgctggttag gtttattggg agggctgatg       360
     gcatttacca caccgctggt aacactctca tttttaatca ccaccccgga ggcatgggta       420
     cccgcattgg gtgacgctca tcatggtttc ccttatttat ccggtgctgg tcgtctggta       480
     ttgaaagata ctctgatgct ggcaggtgct gtcatgataa tggcagattc ggcgcgggaa       540
     attcttaaac aaggcagtaa tgaatccagt tcaacgttaa aaactgaata ttga             594
//

If you have problems or comments...

PBIL Back to PBIL home page