(data stored in ACNUC7421 zone)

EMBL: BA000007.RDGC

BA000007.RDGC        Location/Qualifiers
FT   CDS_pept        complement(471195..472172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECs_0444"
FT                   /product="recombination-associated protein rdgC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33868"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33868"
FT                   /db_xref="GOA:Q8XEA0"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA0"
FT                   /protein_id="BAB33868.2"
FT                   /translation="MQGRRQFVIMPAKFNDKAVEIIMLWFKNLMVYRLSREISLRAEEM
FT                   EKQLASMAFTPCGSQDMAKMGWVPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQ
FT                   ALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDC
FT                   ASAKKAEDTLALLRKSLGSLPVVPLSMANPIELTLTEWVRSGSAAQGFQLLDEAELKSL
FT                   LEDGGVIRAKKQDLTSEEITNHIEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDEL
FT                   RDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLGGEAQR"
     atgcaaggcc gccgacaatt cgttatcatg cccgctaaat ttaacgacaa ggccgtggaa        60
     attatcatgc tgtggttcaa aaatttaatg gtttaccgtc ttagccgcga gatttcgctg       120
     cgtgcagaag agatggaaaa acagctagcc tcgatggcat ttaccccatg cggcagccag       180
     gacatggcga agatgggctg ggttcctccg atgggatcgc acagcgatgc gttaacgcac       240
     gttgccaatg gtcaaattgt tatctgcgcg cgcaaagaag aaaaaatcct accgtctccg       300
     gtgattaaac aggcgctgga agcgaaaatc gccaaactgg aagcggaaca ggcgcgtaag       360
     ctgaagaaaa ccgaaaaaga ttcgctgaaa gacgaagtgc tgcactctct gttgccgcgt       420
     gctttcagcc gttttagcca gacaatgatg tggatcgaca cggttaacgg tttgattatg       480
     gtggactgcg ccagtgccaa aaaagcggaa gatacgctgg cactgctgcg taaaagcctg       540
     gggtcgttac cggttgtacc attgagcatg gcaaacccga ttgaactgac gctgaccgaa       600
     tgggtacgtt ccggtagtgc ggcacagggc ttccagctgc ttgatgaagc cgagctgaaa       660
     tcgttgctgg aagatggcgg agtgatccgc gcgaagaaac aagatctgac cagcgaagag       720
     atcaccaatc acattgaagc cggaaaagtg gtgactaaac tggcgctcga ctggcagcag       780
     cgcattcagt ttgtgatgtg cgacgatggt tcgctcaagc gtctgaagtt ctgcgacgag       840
     ctgcgcgatc aaaacgaaga tatcgaccgt gaagatttcg cccagcgttt tgatgccgat       900
     ttcatcctga tgactggtga actggcagcg ttaattcaaa acctgattga aggattaggt       960
     ggcgaagcac aacgttaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page