(data stored in ACNUC7421 zone)

EMBL: BA000007.RHSC

BA000007.RHSC        Location/Qualifiers
FT   CDS_pept        267079..271293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsC"
FT                   /locus_tag="ECs_0237"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33660"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33660"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XED9"
FT                   /protein_id="BAB33660.2"
FT                   /translation="MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITY
FT                   ANPVNPVLGAKVLPGETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRL
FT                   QIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLP
FT                   EDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAF
FT                   HRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLV
FT                   FPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGT
FT                   QVRGFAYDAEHAGRMVAHHYAGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTIT
FT                   DSLNRREVLYTEGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMA
FT                   SGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRY
FT                   SYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREE
FT                   GISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVST
FT                   TQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKL
FT                   TQSEDEGLVTLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGY
FT                   DDKGRLTGERQTVENPETGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLA
FT                   GMKLGGTPLVEYMRDRLHRETARSFGGEAYELATAWNTSGQLRSRHLNLPQLDRDYDWN
FT                   DNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPELHPDS
FT                   TLTAWPDNRIAEDAHYVYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFH
FT                   TRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTV
FT                   QTQQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGR
FT                   LERELRQGSVSEESQQWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPLALISP
FT                   EGETAWQGEYDEWGNLLGETSAQHLQQSLRLPGQQYDEESGLYYNRNRYYDPLQGRYIT
FT                   QDPIGLEGGWNLYQYPLNPIEHIDPLGLALDLNYYSPSDPIYKGSLNVREFPTGFTVGG
FT                   HGSPTSMSDDRIKKGSDLTIKQLASDIRANPKYHEGMPVVLFSCETGKGKNSFAQKLAN
FT                   ELDATVIAPDEIIWIWPDGNYAIMGQTARITIGGKDNGVFELVPDEKQPGDFHKFTPTG
FT                   SK"
     atgggaggaa aaccggcggc gcggcagggt gacatgaccc gcaagggact ggatattgtg        60
     cagggttcag caggggtgct gataggtgcg ccgacgggcg tggcctgctc ggtgtgtccg       120
     ggagggatta cctatgctaa cccggtgaac ccggtgctgg gtgcgaaggt gctgccgggc       180
     gagacggacc ttgcgctgcc cggcccgctg ccgtttattc tttcccgcgc ctacagcagc       240
     taccggacca gaacacccgc gccggtgggg gtgtttggtc ccggctggaa agcgcccttc       300
     gatatccgct tacagatacg cgatgaaggc ctgatactca acgacaacgg cggcaggagc       360
     attcactttg agccgctgtt tcccggcgag ataagctaca gccgcagcga gtcgttctgg       420
     ctggcgcggg gcggggtggc ggagcagcac agttcgcagc cgctaagcgc gctctggcag       480
     gtgctgccgg aagatgttcg cctgagtccg catatgtacc tggcgacaaa cagccttcag       540
     gggccgtggt ggatactcaa ctggccggag cgggtgccgg gggcggacga ggtgctgccg       600
     ccggagccgc ccgcataccg ggtgctgacg ggcgtggtgg atggcttcgg gcggacgctg       660
     gcctttcacc gggcggcgga gggtgatgtg gcgggcgcgg tgacgggggt gacggacggc       720
     gcgggccgcc gttttcacct ggtgctgacc acacaggcac agcgggcgga agtattccgt       780
     aaacagcgcg ccacgtcttt atcttcccct gccggtcccc gttctgcttc ctcttctctg       840
     gttttccccg acacgctgcc cgccggtaca gaatacggtg ccgataacgg tatccggctg       900
     gaggcggtat ggctgacaca cgacccggca tacccggatg aactgcccgc cgcgccgctg       960
     gcgcgctaca cgtacacggc cagcggagaa ctgcgggcgg tgtatgaccg cagcgggacg      1020
     caggtgcgcg ggtttgctta tgatgcggag cacgccgggc ggatggtggc gcaccattat      1080
     gcgggtaggc cggagagccg ctaccggtat gatgataccg gccgggtgac ggagctggtc      1140
     aacccggagg ggctggacta ccgctttgag tacgggcagg accgtgtgac catcacggac      1200
     agcctgaacc ggcgggaggt gctgtacacg gaaggcgagg gtggcctgaa acgtgttgtg      1260
     aagaaggaac atgcggacgg gagcatcacc cgcagcgagt atgatgaggc ggggaggctg      1320
     aaggcacaga cggatgcggc gggacggcgg acggagtaca gcctgcatat ggcgtcgggt      1380
     gcggtgacag cggtgacggg gccggacggc aggacggtgc ggtatggcta taacagccag      1440
     cggcaggtga cgtcagtgac gtacccggac gggctgcgca gcagccggga gtatgatgag      1500
     aagggaaggc tggcggcgga gacctcgcgc agcggagaga cgacgcggta cagctatgat      1560
     gacccggcga gtgagctgcc gacagggata caggacgcga cgggcagtac aaaacagatg      1620
     gcatggagcc gttacggtca gctgctgacc tttacggact gctcggggta cacgacgcgg      1680
     tatgagtatg accggtacgg tcaacaaatc gccgttcacc gggaagaagg catcagcact      1740
     tacagcagtt ataacccgcg tggccaactg gtcagtcaga aggatgcgca ggggcgtgaa      1800
     acccgttatg agtacagcgc cgcaggcgac ctcaccgcta tcgttgcccc ggacggcagc      1860
     cgcagtgaga tacagtatga tgcgtgggga aaggccgtca gcaccacgca gggcggtctg      1920
     acgcgcagca tggggtatga cgctgccggg cgcatcaccg tgctgaccaa cgagaacggc      1980
     agccagtcca cgttccggta tgacccggtg gacaggctga ctgaacagcg cggttttgat      2040
     ggccggacgc aacgttacca ctatgacctg accggaaaac tcacgcagag tgaagacgag      2100
     gggcttgtca ccctctggca ctacgatgcg tcggaccgca tcacgcaccg gacggtgaac      2160
     ggcgacccgg cagagcagtg gcagtatgat gagcacgggt ggctaaccac cctcagccat      2220
     accagtgaag gccaccgggt gtcggtccac tacggctatg acgataaagg ccgcctgacg      2280
     ggtgaacggc agacggtgga gaacccggag acgggggaga tgctgtggga gcatgagacg      2340
     gggcacgcgt acagcgaaca ggggctggcg acccgtcagg agccggacgg tctgccgccg      2400
     gtagagtggc tgacgtatgg cagcggttat cttgcgggga tgaagctggg cggaacgcca      2460
     ctggtcgagt acatgcggga ccggctgcac cgtgagacgg cccgcagctt cggcggggag      2520
     gcatatgaac ttgccaccgc ctggaatacc agcggccagc tccggagcag gcacctgaac      2580
     cttccgcagc ttgaccgtga ctacgactgg aacgacaacg gacagctaat ccgcatcagc      2640
     ggcccgcagg agagccggga gtaccgttac agtgacacgg gaaggctgac gggcgtccac      2700
     accacggcag cgaacctgga tatcgatatc ccgtatgcaa cggacccggc aggaaaccgg      2760
     ctgccggacc cggaactgca cccggacagc accctcacgg catggccgga taaccgcatc      2820
     gcggaagatg cgcactatgt ctaccgctac gatgaatacg gcaggctggc ggagaagacg      2880
     gaccgcatcc cggaaggggt tatccggatg cacgacgagc gcacccacca ctatcactac      2940
     gacagccagc accgcctggt gttccacacg cggatacagc acggcgaacc acaggtggag      3000
     agccggtacc tctatgaccc gctgggccgc cggacgggaa aacgggtgtg gcggcgggag      3060
     cgtgacctga cggggtggat gtcgctgtcg cgtaaaccgg aggagacctg gtacgggtgg      3120
     gacggtgaca ggctgaccac tgtacagacc caacagacaa gaatccagac ggtataccag      3180
     ccgggaagct tcacgccgct cctgagaatc gaaacagaga atggtgaaca ggcgaaggcg      3240
     cggcaccgta gcctggcgga ggtgttgcag gaggacacgg gtgtgacgct accggcggag      3300
     ctggcggtga tgctgggaag gctggagcgg gagctgcggc agggcagcgt gagtgaagaa      3360
     agccagcagt ggcttgcgca gtgcgggctg acggcggagc agatggccgc gcagctggag      3420
     gcggaataca tcccggagag gaaacttcat ctttaccact gcgaccaccg gggactgccg      3480
     ctggcgctca tcagcccgga aggggaaacg gcgtggcagg gggagtatga cgagtgggga      3540
     aacctgctgg gcgaaaccag cgcgcagcac cttcaacagt cactccgtct gccggggcag      3600
     cagtatgatg aggagtcggg gctgtactac aaccgcaacc ggtactatga tccgttgcag      3660
     gggagatata tcacccagga cccgataggg ctggaggggg gatggaacct gtatcagtac      3720
     ccactcaatc ctattgaaca tatagatccg ttggggttag cacttgattt gaattattat      3780
     tctccgtcag atcctatata taaaggttct cttaatgtaa gggaatttcc aacgggtttt      3840
     acagttggag gtcatggttc gcctacatct atgagtgatg acagaatcaa aaaaggaagt      3900
     gatctgacaa taaaacaatt agctagcgac ataagagcga atcctaaata tcatgaaggt      3960
     atgcctgtag tcttgttttc ctgcgaaaca ggaaaaggca aaaattcatt tgcacagaaa      4020
     ctagctaacg aacttgatgc tacagtgatt gctcctgatg aaataatatg gatttggccg      4080
     gatggaaact atgctattat ggggcaaaca gctaggataa caataggcgg taaggacaac      4140
     ggggtgtttg aattggtgcc agacgagaaa caaccagggg actttcataa gtttacacct      4200
     acaggaagca aatag                                                       4215
//

If you have problems or comments...

PBIL Back to PBIL home page