(data stored in ACNUC7421 zone)

EMBL: BA000007.RHSD

BA000007.RHSD        Location/Qualifiers
FT   CDS_pept        617058..621254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsD"
FT                   /locus_tag="ECs_0560"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33983"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33983"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEI5"
FT                   /protein_id="BAB33983.2"
FT                   /translation="MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTS
FT                   GNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTRTPAPVGIFGPGWKAPSDIRL
FT                   QLRDDALVLNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALP
FT                   PDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGMADRFGRTLTY
FT                   RREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARKQHTASLSSPDTPRPLSDSAF
FT                   PDTLPGTEYGPDRGIRLSAVWLTHDPAYPESLPAAPLVRYTYTEAGELLAVYDRSNTQV
FT                   RAFTYDAQHPGRMVGHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYHYQYEQDRITVTDS
FT                   LNRREVLHTEGGAGLKRVVKKELADGSVTHSGYDAAGRLTAQTDAAGRRTEYGLNVVSG
FT                   DITDITTPDGRETKFYYNDGNQLTAVVSPDGLESRRAYDEPGRLVSETSRSGETVRYRY
FT                   DDAYSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGI
FT                   SLYRRYDNRGRLISVKDAQGHETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQ
FT                   GGLTRSMEYDLAGRITTLTNENGSRSEFTYDALDRLVQQRGFDGRTQRYHYDLTGKLTQ
FT                   SEDEGLVTLWHYDESDRLTHRTVNGEPAEQWQYDEHGWLTEISHLSEGHQVAVHYGYDD
FT                   KGRLAGERQTVHNPETGELLWQHETEHAYNEQGLANRVTPDSLPRVEWLTYGSGYLAGM
FT                   KLGGTPLVEFTRDRLHRETVRSFGNNAYELTSTYTPAGHLQSQRLNSQVYDRDYDWNDN
FT                   GDLVRISGPRQTREYGYSATGRLESVRTLASDLDIRIPYATDPAGNRLPDPELHPDSTL
FT                   TAWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTR
FT                   IQHGEPLVESRYLYDPLGRRTGKRVWRRGRDLTGWMSLSRKPEVTWYGWDGDRLTTVQT
FT                   DTTRIQTVYEPGSFAPLIRIETDNGEREKAQRRSLAEKLQQEGSEDGHGVVFPAELVRL
FT                   LDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVEPEYTPARKVHLYHCDHRGLPLAL
FT                   ISEDGNTAWSGEYDEWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNRNRYYDPLQGR
FT                   YITQDPIGLEGGWSLYAYPLNPVNGIDPLGLSPADVALIRRKDQLNHQRAWDILSDTYE
FT                   DMKRLNLGGTDQFFHCMAFCRVSKLNDAGVSRSAKGLGYEKEIRDYGLNLFGMYGRKVK
FT                   LSHSEMIEDNKKDLAVNDHGLTCPSTTDCSDRCSDYINPEHKETIKALQDAGYLK"
     atgagcggaa aaccagcggc gcgtcaggga gatatgactc agtatggcgg tcccattgtc        60
     cagggttcgg caggtgtaag aattggcgcg ccaactggcg tggcgtgctc ggtgtgcccg       120
     ggcgggatga cttcgggcaa cccggtaaat ccgctgctgg gggcgaaggt gctgcccggc       180
     gagacggacc ttgcgctgcc cggcccgctg ccgttcattc tctcccgcac ctacagcagc       240
     taccggaccc ggacgcctgc gccggtgggg atttttggcc ccggctggaa agcgccttct       300
     gatatccgct tacagctacg cgatgatgca ctggtactca atgacaacgg cgggcggagc       360
     attcactttg agccgctgct gccgggggag gcggtgtaca gccgcagcga gtcaatgtgg       420
     ctggtgcgcg gtggtaaggc agcgcagccg gacggccaca cgctggcgcg gctgtggggg       480
     gcgctgccgc cggatatccg gttaagcccg catctttacc tggcgaccaa cagcgcacag       540
     gggccgtggt ggatactggg gtggtcagag cgggtgccgg gtgctgagga cgtactgcca       600
     gcgccgctgc cgccgtaccg ggtgcttacc gggatggcgg accgcttcgg gcggacgctg       660
     acgtacaggc gtgaggccgc cggtgacctg gccggggaaa tcaccggcgt gacggacggt       720
     gccgggcggg agttccgtct ggtgctgacc acgcaggcgc agcgggcgga agaggcccgt       780
     aaacagcaca ccgcttcttt atcttcccct gacacccccc gccctctttc agactcagcg       840
     ttccccgaca cactgcccgg taccgaatac ggtcccgaca gaggtatccg cctttcggcg       900
     gtgtggctga cgcacgaccc ggcatacccg gagagcctgc ccgctgcgcc actggtgcgg       960
     tacacgtata cggaagccgg tgaactgctg gcggtatatg accgcagcaa tacgcaggtg      1020
     cgcgctttca cgtatgacgc gcagcacccg ggccggatgg tggggcaccg ttatgcggga      1080
     aggccggaga tgcgctaccg ctacgacgat gcggggcggg tggtggagca actgaacccg      1140
     gcaggcctga gttaccacta ccagtatgag caggaccgca tcaccgtcac ggacagcctg      1200
     aaccggcgtg aggtgctgca tacagaaggc ggggccgggc tgaagcgggt ggtgaaaaaa      1260
     gaactggcgg acggcagcgt cacgcacagc gggtatgacg cggcaggaag gctaacggcg      1320
     cagacggacg cggcgggacg gcggacagag tatggtctga atgtggtatc cggcgatatc      1380
     acggacatca ccacaccgga cgggcgggag acgaaatttt actataacga cgggaaccag      1440
     ctgacggcgg tggtgtcccc ggacgggctg gagagccgcc gggcatatga tgaaccgggc      1500
     aggctggtat cggagacatc gcgcagcggg gagacagtac gctaccgcta cgatgatgcg      1560
     tacagtgagt taccggcgac gacaacagat gcgacgggca gcacccggca gatgacctgg      1620
     agccgctacg gtcagttgct ggcgttcacc gactgctcgg gctaccagac ccgctatgaa      1680
     tacgaccgct tcggccagat gacggcggtc caccgcgagg aaggcatcag cctttaccgc      1740
     cgctatgaca accgtggccg gttaatctcg gtgaaagacg cacagggcca tgaaacgcgg      1800
     tatgagtaca acgccgcagg cgacctgact gccgttatca ccccggacgg caaccggagc      1860
     gagacacagt acgatgcgtg gggaaaggcg gtcagcacca cgcagggcgg gctgacgcgc      1920
     agtatggaat acgaccttgc cggacgcatc accacgctga ccaacgagaa cggcagccgg      1980
     agtgagttta cctacgatgc gcttgaccgg ctggtacagc agcgcggctt tgacgggcgg      2040
     acgcaacgtt accactatga cctgaccgga aaactcacgc agagtgaaga tgaggggctt      2100
     gtcaccctct ggcactacga cgaatcggac cgcctcactc accgcacggt gaacggcgaa      2160
     ccggcagagc agtggcagta cgacgagcac ggctggctga cagaaatcag ccacctgagc      2220
     gaaggccatc aggtggcggt gcattacggt tatgatgata agggccgcct ggccggggag      2280
     cgccagacgg tgcataaccc ggagacgggg gaactgctgt ggcagcatga gacagagcac      2340
     gcatacaacg aacagggtct ggcaaaccgc gtcacgccgg acagcctgcc gcgggtggag      2400
     tggctgacct acggcagcgg ttatcttgcg gggatgaagc tgggcgggac gccgctggtg      2460
     gagttcacgc gcgacaggct gcaccgcgag acggtgcgca gcttcggcaa taacgcatac      2520
     gaactgacca gcacatacac tcccgcaggc catttacaga gccagcgcct gaacagccag      2580
     gtgtatgacc gtgactacga ctggaatgac aatggcgacc tggtgcgcat cagcggcccg      2640
     cgacagacgc gggaatatgg ctacagcgcc acgggcaggc tggagagcgt gcgcaccctt      2700
     gcatcagacc tggatatccg catcccgtat gcgaccgacc cggcgggaaa ccggctgccg      2760
     gacccggagc tacacccgga cagcacgctc acggcgtggc cggataaccg catcgcggag      2820
     gatgcgcact atgtctaccg acacgatgaa tacggcaggc tgacggagaa gacggaccgc      2880
     atcccggcgg gtgtgatacg gacggacgac gagcggaccc accactacca ctacgacagc      2940
     cagcaccgcc tggtgttcta cacgcggata cagcatggcg agccactggt cgagagccgc      3000
     tacctctacg acccgctggg ccgccggacg gggaaacggg tgtggcgtcg cgggcgtgac      3060
     ctgacgggat ggatgtcgct gtcgcggaaa ccggaggtga cgtggtacgg gtgggacggc      3120
     gaccggctga cgacggtaca gaccgacacc acgcgtatcc agacggtata cgagccggga      3180
     agcttcgcgc cgctcatccg catcgaaaca gacaacggtg agcgggagaa agcgcagcgc      3240
     cgcagcctgg cggagaagct gcagcaggaa gggagcgagg acgggcacgg tgtggtattt      3300
     ccggctgaac tggtgcggct gctggacaga ctggaggaag aaatccgggc agaccgcgtg      3360
     agcagtgaaa gccgggcgtg gcttgcgcag tgcgggctga cggtggagca actggccaga      3420
     caggtggagc cggaatacac accggcgaga aaagttcatc tttaccactg cgaccaccgg      3480
     ggcctgccgc tggcgctcat cagcgaagac ggcaatacgg cgtggagcgg ggagtatgat      3540
     gaatggggca accagctgaa tgaggagaac ccgcatcacc tgcaccagcc gtaccggctg      3600
     ccggggcagc agtatgataa ggagtcgggg ctgtactaca accggaaccg gtactacgat      3660
     ccgttgcagg ggcggtatat cactcaggac ccgatagggc tggagggggg atggagtctg      3720
     tatgcgtatc cgctgaatcc ggtgaatggt attgatccat tagggttaag tcccgcagat      3780
     gtagcgctaa taagaagaaa agatcaacta aaccatcaaa gagcatggga tatattatct      3840
     gatacttatg aagatatgaa gagattaaat ttaggtggga ctgatcaatt tttccattgt      3900
     atggcatttt gtcgagtgtc taaattaaat gacgctggtg ttagccgatc ggcgaaaggg      3960
     ctgggttatg aaaaagagat tagagattac gggttaaatc tgttcggtat gtacggcaga      4020
     aaagtaaagc tatcccattc tgaaatgatt gaagataata aaaaagactt ggctgtaaat      4080
     gaccatgggt tgacatgtcc atcaacaaca gattgctcag atagatgtag tgattatatt      4140
     aatccagagc ataaagaaac gataaaggct ttacaagatg ctggctatct caagtaa         4197
//

If you have problems or comments...

PBIL Back to PBIL home page