(data stored in ACNUC7421 zone)

EMBL: BA000007.RIBD

BA000007.RIBD        Location/Qualifiers
FT   CDS_pept        497711..498814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ECs_0467"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33890"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33890"
FT                   /db_xref="GOA:Q8XE88"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE88"
FT                   /protein_id="BAB33890.1"
FT                   /translation="MQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWSELDVQTQALYPQH
FT                   HLRQPVRIVIDSQNRVTPEHHIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDL
FT                   VVLMMQLGKQQINSIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLE
FT                   KLADAPQFKFKEIRHVGPDVCLHLVGA"
     gtgcaggacg agtattacat ggcgcgggcg ctaaagctgg cgcaacgagg acgttttacc        60
     acccacccca acccgaatgt cgggtgcgtc attgtcaaag atggcgaaat tgtcggtgaa       120
     ggttaccacc aacgagcggg tgaaccacat gccgaagtac acgcgttgcg tatggcgggt       180
     gaaaaagcca aaggtgcgac cgcctatgtc acactcgaac cctgtagcca tcatggtcgt       240
     acgccaccgt gctgtgacgc actcatcgcc gctggcgtag cgcgcgtggt cgctgcgatg       300
     caggacccga acccgcaggt cgctgggcgt ggactttacc gtctgcaaca ggctggcatt       360
     gacgtcagcc acggcctgat gatgagtgaa gccgagcaat tgaataaagg ctttctcaag       420
     cggatgcgca ccggctttcc ttatattcag ttaaaacttg gcgcatcgct tgatggccgc       480
     acggcgatgg cgagcggcga aagccagtgg atcacttcgc ctcaggcgcg gcgcgacgta       540
     caacgactgc gcgcacaaag tcatgccatt ttaaccagca gcgctacggt gctggcggat       600
     gatcctgcct taacggtgcg ttggtctgaa ctggatgtac aaactcaggc gctctacccg       660
     caacatcatc tccgccagcc ggtacgtatt gtgattgata gccaaaatcg cgtgacgccg       720
     gaacatcaca ttgtgcagca gcccggcgaa acctggttcg cgcgtacgca ggaagattct       780
     cgtgagtggc cggaaacggt gcgtaccttg ctgattccag agcataaagg tcatctggat       840
     ctggttgtac tgatgatgca actgggtaaa cagcagatta acagcatctg ggtggaagcg       900
     gggccaacgc tcgctggcgc attgctgcag gcggggttag tcgatgagct gattgtctat       960
     atcgcaccta aactattagg cagcgacgcc cgtggattat gcacactgcc agggcttgag      1020
     aaattagctg acgcccccca atttaaattc aaagagatac gtcatgtagg cccggatgtt      1080
     tgcctgcatt tagtgggtgc atga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page