(data stored in ACNUC7421 zone)

EMBL: BA000007.RPSB

BA000007.RPSB        Location/Qualifiers
FT   CDS_pept        193361..194086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ECs_0171"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33594"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33594"
FT                   /db_xref="GOA:P0A7V2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7V2"
FT                   /protein_id="BAB33594.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
     atggcaactg tttccatgcg cgacatgctc aaggctggtg ttcacttcgg tcaccagacc        60
     cgttactgga acccgaaaat gaagccgttc atcttcggtg cgcgtaacaa agttcacatc       120
     atcaaccttg agaaaactgt accgatgttc aacgaagctc tggctgaact gaacaagatt       180
     gcttctcgca aaggtaaaat ccttttcgtt ggtactaaac gcgctgcaag cgaagcggtg       240
     aaagacgctg ctctgagctg cgaccagttc ttcgtgaacc atcgctggct gggcggtatg       300
     ctgactaact ggaaaaccgt tcgtcagtcc atcaaacgtc tgaaagacct ggaaactcag       360
     tctcaggacg gtactttcga caagctgacc aagaaagaag cgctgatgcg cactcgtgag       420
     ctggagaaac tggaaaacag cctgggcggt atcaaagaca tgggcggtct gccggacgct       480
     ctgtttgtaa tcgatgctga ccacgaacac attgctatca aagaagcaaa caacctgggt       540
     attccggtat ttgctatcgt tgataccaac tctgatccgg acggtgttga cttcgttatc       600
     ccgggtaacg acgacgcaat ccgtgctgtg accctgtacc tgggcgctgt tgctgcaacc       660
     gtacgtgaag gccgttctca ggatctggct tcccaggcgg aagaaagctt cgtagaagct       720
     gagtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page