(data stored in ACNUC7421 zone)

EMBL: BA000007.RSMA

BA000007.RSMA        Location/Qualifiers
FT   CDS_pept        complement(56585..57406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmA"
FT                   /locus_tag="ECs_0056"
FT                   /product="ribosomal RNA small subunit methyltransferase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33479"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33479"
FT                   /db_xref="GOA:Q8XA14"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA14"
FT                   /protein_id="BAB33479.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENAPFQES"
     atgaataatc gagtccacca gggccactta gcccgtaaac gcttcgggca aaactttctc        60
     aacgatcagt tcgtgatcga cagcattgtt tctgccatta acccgcaaaa gggccaggca       120
     atggtcgaaa tcggccccgg tctggcggca ttgaccgagc cggtcggcga acgtctggac       180
     cagctgacgg tcatcgaact tgaccgcgat ctggcggcac gtctgcaaac gcatccattc       240
     ttaggcccga aactgacgat ttatcagcag gatgcgatga cctttaactt tggcgaactg       300
     gccgagaaaa tgggtcagcc gctgcgtgtt ttcggcaacc tgccttataa catctccacg       360
     ccgttgatgt tccatctgtt tagctatact gatgccattg ccgacatgca ctttatgttg       420
     caaaaagagg tggtgaatcg tctggttgca ggaccgaaca gcaaagcgta tggtcgatta       480
     agcgtcatgg cgcaatacta ttgcaacgtg atcccggtac tggaagttcc gccgtcagcc       540
     tttacaccac cacccaaagt ggattccgcc gtcgtgcgcc tggttcctca tgcaacgatg       600
     cctcacccgg ttaaagatgt tcgtgtgttg agccgcatca ccaccgaagc ctttaaccag       660
     cgtcgtaaaa ccattcgtaa cagcctcggc aacctgttta gcgtcgaggt gttaacggga       720
     atggggatcg acccggcgat gcgagcggaa aatatctctg tcgcgcaata ttgccagatg       780
     gcgaactatc tggcggagaa cgcgcctttt caggagagtt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page