(data stored in ACNUC7421 zone)

EMBL: BA000007.SBMA

BA000007.SBMA        Location/Qualifiers
FT   CDS_pept        456419..457639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ECs_0427"
FT                   /product="peptide antibiotic transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33850"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33850"
FT                   /db_xref="GOA:P0AFY7"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFY7"
FT                   /protein_id="BAB33850.1"
FT                   /translation="MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
     atgtttaagt cttttttccc aaagccggga acgttttttc tctcggcctt tgtttgggca        60
     ttgattgccg ttatcttctg gcaagccggt gggggggact gggtggcgcg tatcaccggc       120
     gcttccgggc agatcccgat tagcgccgcg cgtttctggt cgttggattt cctgattttt       180
     tacgcttact acattgtttg cgtaggactt tttgcattgt tctggtttat ctacagcccg       240
     caccgttggc aatactggtc aatactcggt actgcactga tcatcttcgt cacctggttt       300
     ttggtggaag ttggggttgc cgtcaacgcc tggtatgcac cgttctatga tctgattcaa       360
     accgcgctaa gttcgccgca taaagtcact atcgaacaat tttaccgcga agtgggcgtc       420
     tttctgggga ttgcgctgat cgcggtagtg atcagtgtgc tgaataactt ctttgtcagt       480
     cactacgtgt tccgctggcg tacggcgatg aacgaatatt acatggcgaa ctggcaacaa       540
     ctgcgtcata tcgaaggcgc cgcacagcgt gtgcaggaag acaccatgcg ttttgcttca       600
     acgctggaga atatgggtgt cagttttatc aacgccatca tgacgttgat cgccttcctg       660
     ccggtgttgg taacgctctc cgcgcatgtg ccggagctgc cgattatcgg gcacattccg       720
     tatggtctgg tgattgccgc tatcgtctgg tcgctgatgg ggaccggatt gctggcagtg       780
     gtagggatca aactgccggg gctggagttt aaaaaccagc gtgtagaggc tgcctaccgt       840
     aaagagctgg tttatggtga agacgatgcc acgcgcgcga cgccgccaac ggtacgcgag       900
     ctgtttagcg ccgtacggaa aaactatttc cgcctctatt ttcactatat gtatttcaac       960
     atcgctcgca ttctctattt gcaggtcgat aacgttttcg gtttgttctt gctgtttccg      1020
     tcaattgttg ccggtacgat tacgctcggc ctgatgacgc agattaccaa cgtttttggt      1080
     caggttcgcg gtgctttcca gtacctgatt aactcatgga ccacactggt tgagttgatg      1140
     tctatctaca aacgtctgcg cagctttgaa catgagctgg atggtgacaa aattcaggaa      1200
     gtaacccata ccttgagcta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page