(data stored in ACNUC7421 zone)

EMBL: BA000007.SECD

BA000007.SECD        Location/Qualifiers
FT   CDS_pept        491310..493124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ECs_0459"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33882"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33882"
FT                   /db_xref="GOA:P0AG91"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG91"
FT                   /protein_id="BAB33882.2"
FT                   /translation="MLIVVIVIGLLYALPNLFGEDPAVQITGARGVAASEQTLIQVQKT
FT                   LQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALNLAPATPRWLAA
FT                   IHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNY
FT                   GLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEAREYAVQQNINI
FT                   LRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAA
FT                   AASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGN
FT                   IMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITG
FT                   INNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACLAGLLVSILFMI
FT                   IFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERI
FT                   KEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVA
FT                   TSMFTAIVGTRAIVNLLYGGKRVKKLSI"
     atgctgatcg tggtgattgt catcggtctg ctgtatgcgc ttcccaacct gtttggtgag        60
     gatccggctg ttcagatcac tggtgcgcgc ggagtcgccg ccagtgagca aacgctgatc       120
     caggtccaga aaacgttaca agaagaaaaa ataactgcta agtctgtggc actggaagag       180
     ggcgctattc ttgcgcgctt cgactccact gacacccagc tgcgcgctcg tgaagcatta       240
     atgggcgtta tgggtgacaa atacgtcgtg gcgcttaacc ttgccccggc aacgccgcgc       300
     tggctggcag ctattcacgc tgagccgatg aagctcggcc ttgacctgcg tggcggcgtt       360
     cacttcctga tggaagtgga tatggacacc gcgcttggca aactccagga acaaaatatc       420
     gatagcctgc gcagcgacct gcgcgaaaaa ggcatcccgt ataccaccgt tcgtaaagaa       480
     aataactacg gcctgagcat cactttccgc gatgctaaag ctcgtgatga agccattgcg       540
     tatctgagca agcgtcatcc ggacctggtg attagcagtc agggcagcaa ccagctgcgt       600
     gcggtaatga gcgatgctcg tctgagtgaa gcgcgtgaat atgcggtgca gcagaacatc       660
     aatatcctgc gtaaccgtgt aaaccaactt ggcgtggcgg agccggtggt tcagcgtcag       720
     ggtgctgacc gtatcgttgt tgaactgcca ggtattcagg acactgcgcg tgcgaaagag       780
     attctgggtg cgacggcaac gctggaattc cgtctggtaa acaccaacgt tgatcaggcc       840
     gctgcggcat ccggtcgcgt accgggcgac tctgaagtga aacagacccg cgaaggtcag       900
     ccggttgtgc tgtacaaacg cgtaattctt accggtgacc atatcaccga ctccacttcc       960
     agccaggacg aatacaacca gccgcaggtt aacatctcgc tcgatagcgc tggtggcaac      1020
     attatgtcta acttcaccaa ggacaacatc ggcaaaccga tggcaaccct gtttgtggag      1080
     tacaaagaca gcggtaagaa agatgcaaat ggtcgtgcgg ttctggtgaa acaggaagag      1140
     gtgattaaca tcgccaacat ccagtctcgt ctgggtaaca gcttccgtat caccggcatc      1200
     aacaacccga acgaagcccg tcagctgtca ctgctgctgc gtgccggtgc gttgatcgcg      1260
     ccgattcaga ttgttgaaga acgtacaatt ggcccgaccc tgggtatgca gaacattgag      1320
     caggggctgg aggcttgcct tgccggtctg ctggtttcta ttctgttcat gatcatcttc      1380
     tataagaagt ttggtctgat tgcgaccagt gctctgattg ccaacttgat cttgatcgtc      1440
     ggtattatgt cgctgttgcc aggcgcaaca ctgagtatgc caggtatcgc gggtatcgtc      1500
     ttaacccttg cggtagcggt cgatgcgaac gtactgatca acgaacgtat taaagaagag      1560
     ttgagcaacg gacgtactgt tcaacaggca attgatgaag gttatcgtgg cgcattcagt      1620
     tctatcttcg atgcgaacat caccacgctg attaaagtca tcatcctgta cgcagtgggt      1680
     accggggcaa ttaaagggtt cgcgattact accggtatcg gtgtggcgac gtcgatgttt      1740
     accgcgattg tcggtacgcg tgccatcgta aacctgctat atggcggcaa gcgcgtcaag      1800
     aagctgtcaa tctga                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page