(data stored in ACNUC7421 zone)

EMBL: BA000007.SFMF

BA000007.SFMF        Location/Qualifiers
FT   CDS_pept        655790..656305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECs_0596"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34019"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34019"
FT                   /db_xref="GOA:Q8XCR9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR9"
FT                   /protein_id="BAB34019.1"
FT                   /translation="MRRVFFSCFCGLLWSSSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALLPFSLRLEGCPPGSVAILFTGTPASDANLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     atgagaagag tattctttag ctgtttctgc gggttactgt ggagttccag tggatgggca        60
     gctgaccctt taggaacgat taatatcaat ttgcacggta acgttgttga tttctcctgt       120
     accgtaaaca cagcggatat tgataagacg gtagatttag gcagatggcc tacgacacaa       180
     ttactgaacg ctggcgatac cacggcactc ctccctttta gcctgcggct ggagggatgt       240
     cctccgggtt cagttgcgat tttatttacg ggaacgccgg catctgatgc caacctgctg       300
     gctctggatg atcccgcaat ggcacaaacc gtcgccatcg aattacgtaa tagcgatcgc       360
     tcccggctcg cactggggga ggcgagcccg actgaggaag tagatgcaaa tggcaatgtc       420
     acactaaact tttttgccaa ttatcgagcg ttagccagcg gtgttcggcc aggtgtggcg       480
     aaagcggatg cgatatttat gatcaattat aattaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page