(data stored in ACNUC7421 zone)

EMBL: BA000007.SFMH

BA000007.SFMH        Location/Qualifiers
FT   CDS_pept        654772..655779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECs_0595"
FT                   /product="fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34018"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34018"
FT                   /db_xref="GOA:Q8XCS0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCS0"
FT                   /protein_id="BAB34018.2"
FT                   /translation="MKIICRLLLAMACLCLANISWATVCANSTGVAEDEHYDLSNVFNS
FT                   TNNQPGQIVVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLNDYL
FT                   LGAMSLVDSVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIP
FT                   RQVMFTVYVTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAA
FT                   GPGNRPAGVMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQND
FT                   TPITPNDLNSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
     atgaagataa tctgcagatt attattggcg atggcatgtt tgtgtctggc aaacatatcc        60
     tgggctactg tttgtgcaaa tagtactggc gtagcagaag atgaacacta tgatctctca       120
     aatgtcttta atagcaccaa taaccagcca gggcagattg ttgttttacc ggaaaaatcc       180
     ggctgggtag gtgtctcagc aatttgtcca cccggcacgc tggtgaatta tacataccgt       240
     agttatgtca ctaactttat tgttcaggaa actatcgata attataaata tatgcaatta       300
     aatgattatc tattaggtgc gatgagtctg gttgatagtg tgatggatat tcaatttccc       360
     ccgcaaaatt atattcgtat gggaacagat cctaacgttt cgcaaaacct tccgttcggg       420
     gtgatggatt ctcgtttgat atttcgttta aaggttattc ggccctttat taacatggtg       480
     gagatcccca gacaggtgat gtttaccgtg tatgtgacat caacgcctta cgatccgttg       540
     gttacacctg tttataccat tagttttggt ggccgggttg aagtaccgca aaactgcgaa       600
     ttaaatgccg ggcagattgt tgaatttgat tttggtgata tcggcgcatc gttatttagt       660
     gcggcagggc cgggtaatcg gcctgctggt gtcatgccgc aaaccaagag cattgcggtc       720
     aaatgtacga atgttgctgc gcaggcttat ttaacaatgc gtctggaagc cagtgccgtt       780
     tctggtcagg cgatggtgtc ggacaatcag gatttaggtt ttattgtcgc cgatcagaac       840
     gatacgccga tcacgcctaa cgatctcaat agcgttattc ctttccgtct ggatgcagct       900
     gcggcagcca atgtcacact tcgcgcctgg cctatcagta ttaccggtca aaaaccgacc       960
     gaagggccgt ttagcgcgct ggggtattta cgcgtcgatt atcaatga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page