(data stored in ACNUC7421 zone)

EMBL: BA000007.SFSA

BA000007.SFSA        Location/Qualifiers
FT   CDS_pept        complement(165105..165809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ECs_0150"
FT                   /product="sugar fermentation stimulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33573"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33573"
FT                   /db_xref="GOA:P0A824"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A824"
FT                   /protein_id="BAB33573.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
     atggaatttt ctccccctct acagcgcgcg acgctaattc agcgttacaa acgtttttta        60
     gccgatgtga tcacacccga tggtcgcgaa ttaacgctac actgcccgaa tacgggtgcg       120
     atgaccggtt gtgcaacgcc tggcgatacc gtctggtatt cgacttcaga caacaccaaa       180
     cggaaatacc cacacacctg ggaattaact caaagccaga gcggcgcatt tatttgcgtc       240
     aacacgcttt gggctaacag gttgacgaaa gaggctatcc ttaatgaatc aatttcagaa       300
     ctgtcaggct atagctcgct gaaaagcgaa gtaaaatacg gcgcagaacg cagccgtatt       360
     gactttatgt tgcaggcgga ttcgcgtcca gactgctata ttgaagtgaa atcggttacg       420
     ttagcggaga acgaacaggg atattttccc gatgcggtca ctgaacgagg tcagaaacac       480
     cttcgggagt tgatgagcgt agcggctgaa ggccagcgtg cggttatctt tttcgccgtg       540
     ctgcattcag ccattacacg gttttcaccc gcgcgccaca tcgatgagaa atacgcgcaa       600
     ctattgtcag aagctcaaca gaggggggta gaaattctgg cttacaaagc ggaaatttct       660
     gctgaaggca tggctcttaa aaaatcactg ccggttacat tgtag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page