(data stored in ACNUC7421 zone)

EMBL: BA000007.THIB

BA000007.THIB        Location/Qualifiers
FT   CDS_pept        complement(79317..80300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="ECs_0072"
FT                   /product="thiamine/thiamine pyrophosphate/thiamine
FT                   monophosphate ABC transporter periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33495"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33495"
FT                   /db_xref="GOA:Q8XA04"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA04"
FT                   /protein_id="BAB33495.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     gtgttaaaaa aatgtcttcc cctgctgttg ctgtgcacag cgcccgtttt cgctaaaccc        60
     gttctgactg tttataccta cgattccttc gccgccgact gggggcctgg tccggtggtt       120
     aaaaaagcct ttgaagccga ctgtaattgc gaactgaaac tggtggcgct ggaagatggc       180
     gtttcgcttc tcaaccgtct acggatggaa ggcaaaaaca gtaaagccga tgtggtgctg       240
     gggctggata acaatctgtt agacgccgcc agtaaaaccg gactgtttgc caaaagcggt       300
     gtggcagcgg atgccgttaa cgttcccggc ggctggaata atgacatttt cgtaccgttt       360
     gattatggct acttcgcctt cgtttatgac aagaacaaac tgaaaaaccc gccacaaagc       420
     ctgaaagaac tggttgagag cgatcaaaac tggcgggtga tttatcagga tccgcgcacc       480
     agtacaccgg ggctgggtct gttgctatgg atgcaaaaag tctatggcga tgacgcccca       540
     caagcctggc agaaactggc gaagaaaacg gtcacggtca ccaaaggctg gagcgaagcc       600
     tacggcctgt ttttaaaagg tgaaagcgat ctggtactga gttacaccac ctctccggct       660
     tatcacattc tcgaagagaa gaaagataac tacgccgccg cgaacttcag cgaaggtcac       720
     tatctgcaag tggaagtcgc cgctcgcacc gctgccagca agcagccgga gctggcgcaa       780
     aaattcctcc agtttatggt ttctccggct ttccagaatg cgatcccaac cggcaactgg       840
     atgtatccgg tggcaaacgt cacgctgcct gccggttttg aaaaattgac caaacccgca       900
     accacgctgg agttcacgcc agccgaagtg gcggcacaac gtcaggcatg gattagcgaa       960
     tggcaacgcg ccgtcagccg ttaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page