(data stored in ACNUC7421 zone)

EMBL: BA000007.THIL

BA000007.THIL        Location/Qualifiers
FT   CDS_pept        499890..500867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECs_0470"
FT                   /product="thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33893"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33893"
FT                   /db_xref="GOA:Q8XE87"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE87"
FT                   /protein_id="BAB33893.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVVPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTLDWKGYDHFATP"
     atggcatgtg gcgagttctc cctgattgcc cgttattttg accgtgtaag aagttctcgt        60
     cttgatgtcg aactgggcat cggcgacgat tgcgctcttc tcaatatccc cgagaaacag       120
     accctggcga tcagcactga tacgctggtg gcgggcaacc atttcctccc tgatatcgat       180
     cctgctgatc tggcttataa agcactggcg gtgaacctaa gcgatctggc agcgatgggg       240
     gccgatccgg cctggctgac gctggcatta accttaccgg acgtagacga agcgtggctt       300
     gagtccttca gcgacagttt gtttgatctt ctcaattatt acgatatgca actcattggc       360
     ggcgatacca cgcgtgggcc attatcaatg acgttgggta tccacggctt tgttccgatg       420
     ggacgagcct taacgcgctc tggggcgaaa ccgggtgact ggatctatgt gaccggtaca       480
     ccgggcgata gcgccgccgg gctggcgatt ttgcaaaacc gtttgcaggt tgccgatgct       540
     aaagatgcgg actacttgat caaacgtcat ctccgtccat cgccgcgtat tttacagggg       600
     caggcactgc gcgatctggc aaattcagct atcgatctct ctgacggtct gatttccgat       660
     ctcgggcata tcgtgaaagc cagcgactgc ggcgcacgta ttgacctggc attgctgccg       720
     ttttctgatg cgctttctcg ccatgttgta ccggaacagg cgctgcgctg ggcgctctct       780
     ggcggtgaag attacgagtt gtgtttcacg gtgccggaac tgaaccgtgg cgcgctggat       840
     gtggctctcg gtcatctggg cgtaccgttt acctgtatcg ggcaaatgac cgccgatatc       900
     gaagggcttt gttttattcg tgacggcgaa cctgtcacgt tagactggaa aggatatgac       960
     cattttgcca cgccataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page