(data stored in ACNUC7421 zone)

EMBL: BA000007.THRB

BA000007.THRB        Location/Qualifiers
FT   CDS_pept        2818..3750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ECs_0003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33426"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33426"
FT                   /db_xref="GOA:Q8XA82"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA82"
FT                   /protein_id="BAB33426.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVESAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
     atggttaaag tttatgcccc ggcttccagt gccaatatga gcgtcgggtt tgatgtgctc        60
     ggggcggcgg tgacacccgt tgatggtgca ttgctcggag atgtagtcac ggttgagtcg       120
     gcagagacat tcagtctcaa caacctcgga cgctttgccg ataagctgcc gtcagaacca       180
     cgggaaaata tcgtttatca gtgctgggag cgtttttgcc aggagctggg caagcaaatt       240
     ccagtggcga tgactctgga aaagaatatg ccgatcggtt cgggcttagg ctccagcgcc       300
     tgttcggtgg tcgcggctct gatggcgatg aatgaacact gcggcaagcc gcttaatgac       360
     acccgtttgc tggctttgat gggcgagctg gaaggacgaa tctccggcag cattcattac       420
     gacaacgtgg caccgtgttt tcttggtggt atgcagttga tgatcgaaga aaacgacatc       480
     atcagccagc aagtgccagg gtttgatgag tggctgtggg tgctggcgta tccggggatt       540
     aaagtctcga cggcagaagc ccgggctatt ttaccggcgc agtatcgccg ccaggattgc       600
     attgcgcacg ggcgacactt ggcaggcttc attcacgcct gctattcccg tcagcctgag       660
     cttgccgcga agctgatgaa agatgttatc gcagaaccct accgtgaacg gttactgcct       720
     ggcttccggc aggcgcggca ggcggtcgcg gaaatcggcg cggtagcgag cggtatctcc       780
     ggctccggcc cgaccttgtt tgctctgtgt gacaagccgg ataccgccca gcgcgttgcc       840
     gactggttgg gtaagaacta cctgcaaaat caggaaggtt ttgttcatat ttgccggctg       900
     gatacggcgg gcgcacgagt actggaaaac taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page