(data stored in ACNUC7421 zone)

EMBL: BA000007.USPG

BA000007.USPG        Location/Qualifiers
FT   CDS_pept        complement(722794..723222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspG"
FT                   /locus_tag="ECs_0646"
FT                   /product="universal stress protein UP12"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34069"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34069"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBT3"
FT                   /protein_id="BAB34069.1"
FT                   /translation="MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSAS
FT                   LSLHRFAADVRRFEEHLQHEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEEL
FT                   GADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR"
     atgtataaga caatcattat gccagttgat gtatttgaaa tggaattgag cgacaaagct        60
     gttcgccacg ctgaattcct cgcccaggat gacggagtta ttcatctact tcacgtacta       120
     cccgggtcag ccagcctgag cctgcaccgt tttgccgctg atgtgcgtcg ttttgaagag       180
     catctgcaac atgaagcaga agaacgtttg caaacgatgg tcagccactt caccatcgat       240
     ccttcccgca ttaaacaaca tgtccgtttt ggtagcgtgc gggatgaagt caatgagtta       300
     gcagaagaac tgggggctga tgttgtagtt attggttctc gcaacccatc gatttcgacc       360
     catctgttag gttctaacgc ctcgagcgtg atccgccacg ccaatctgcc tgtactggtc       420
     gttcgctaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page