(data stored in ACNUC7421 zone)

EMBL: BA000007.VGRE

BA000007.VGRE        Location/Qualifiers
FT   CDS_pept        264862..267003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrE"
FT                   /locus_tag="ECs_0236"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33659"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33659"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC38"
FT                   /protein_id="BAB33659.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVFFHLNQSLSSLFSLALSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIASILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVLYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQILNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
     atgtcaaccg gattacgttt cacgctggaa gtggacggcc tgccaccgga tgcttttgcg        60
     gtggtcttct ttcatctgaa ccagtcactc tcttcgcttt tttccctcgc tctctctctg       120
     gtcagccagc agtttctctc ccttgaattc cagcagatcc tcgacaaaat ggcctacctg       180
     acgatatggc agggcgatga cgtacagcgc cgggtgaaag gtgtggtgac ctggtttgaa       240
     ctgggggaga acgacaaaaa ccagaagctg tacagcatga aggtgtgccc gccgctgtgg       300
     cgcacagggc tgcgccagaa cttccgtatc ttccagaatg aggacatcgc aagcatcctc       360
     ggcacgatat tgcaggaaaa cggggtgacc gagtggagcc cgctgttcag cgagccacat       420
     ccttcccgtg agttttgtgt ccagtacggt gagactgatt acgatttcct gtgccggatg       480
     gcggcggagg aaggcatctt cttttatgag gagcacgcgc aaaaaagtac cgaccagagc       540
     ctggtcctgt gcgataccgt gctttatctg ccggagtcct ttgagatccc ctggaatccg       600
     aacacccgta ccgaggtaag caccctctgc atcagccagt ttcgctacag cgcacaaatc       660
     cgcccttctt ccgtggtgac caaagactac acctttaaac gccccggctg ggccggacgt       720
     tttgaccagg aaggccagca ccaggattac cagcgcacac agtatgaagt gtatgactat       780
     cccggacgtt tcaagggcgc ccacgggcag aactttgccc gctggcagat ggacggctgg       840
     cgaaacaacg cagaagtggc gcgcggaaca agccgttcgc cggagatatg gccgggacgg       900
     cgaattgtgc tgacggggca tccgcaggcg aacctgaacc gggaatggca ggtggtggca       960
     agtgaactgc acggtgagca gccgcaggcg gtgccgggac gcaggggttc aggcaccacg      1020
     ctggataacc attttgcggt aataccggca gacagaacat ggcgaccaca gccgttgctg      1080
     aaaccgctgg tggacggccc gcagagcgcc gtcgtgacgg gaccggcagg cgaggaaatc      1140
     ttctgtgatg aacatggccg cgtgcgggtg aaatttaact gggaccgcta taacccgtca      1200
     aaccaggaca gttcatgctg gatccgtgtg gcacaggcgt gggcaggcac cgggtttggt      1260
     aacctggcga taccgcgtgt gggtcaggag gtcattgtgg acttcctcaa cggcgatccg      1320
     gaccagccga tcattatggg gcgtacctac caccaggaaa accgcacacc cggtagcctg      1380
     ccggggacga agacgcagat gaccattcgt tcgaaaacct ataagggcag cgggtttaat      1440
     gaactgaagt ttgacgatgc gacagggaaa gaacaggtct acatccacgc gcagaagaac      1500
     atgaacaccg aggtgctgaa taaccgcacc acggatgtga taaacaacca tgccgaaaaa      1560
     ataggtaaca accaggcgat caccgttacc aataaccaga tcctgaacat tggcgttaat      1620
     cagatacaga cggttggtgt caaccaggtg gaaacggtag gcagtaacca gattatcaaa      1680
     gtgggatcaa accaggttga aaaggtgggg atcattcgtg cgctgacggt gggtgtggcg      1740
     tatcagacga cggtaggcgg cattatgaat acctcggtgg cgttgttgca gtcctcacag      1800
     gtagggctgc ataaatcact gatggtggga atgggctaca gcgtcaatgt agggaataac      1860
     gtcaccttct cggtgggcaa gacgatgaag gaaaacaccg gacaaacagc agtttattct      1920
     gccggtgagc atcttgaact ctgctgtggt aaggcaaggc tggtgctgac gaaggacgga      1980
     agcatatttc ttaatggtac gcacattcat ctggaagggg agtcggatgt gaacggtgat      2040
     gcgccggtga ttaactggaa ctgtggtgcc acacaacctg taccggatgc gcctgtgccg      2100
     aaagatttac cccccggaat gccggatatg cggcaatttt ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page