(data stored in ACNUC7421 zone)

EMBL: BA000007.YAAA

BA000007.YAAA        Location/Qualifiers
FT   CDS_pept        complement(5700..6476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="ECs_0006"
FT                   /product="peroxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33429"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33429"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA76"
FT                   /protein_id="BAB33429.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
     atgctgattc ttatttcacc tgcgaaaacg cttgattacc aaagcccgtt gaccaccacg        60
     cgatatacac tgccggagct gttagacaat tcccagcagt tgatccatga agcgcggaaa       120
     ctgacgcctc cgcagattag cacgctgatg cgtatcagcg acaaactggc aggtatcaac       180
     gccgctcgct ttcatgactg gcagccagat ttcacgccgg agaatgcccg ccaggcgatt       240
     ctggcgttta aaggtgatgt ctacaccggc ttgcaggccg aaaccttcag cgaagacgat       300
     ttcgattttg cccaacagca tttgcgaatg ctttccggct tgtatggcgt actccgcccg       360
     ctcgatttaa tgcagcctta tcgtctggaa atggggatcc gtcttgagaa tgcccgaggg       420
     aaagatctgt atcaattctg gggagatatc atcaccaaca agctgaacga ggcgctcgca       480
     gcacaaggcg ataatgtggt gattaatctg gcgtcagatg agtattttaa atcggtgaag       540
     ccgaagaaat tgaatgccga gattatcaag ccggtgttcc tcgatgagaa gaacggcaaa       600
     tttaagataa tcagcttcta cgctaagaaa gcacgcggtc tgatgagtcg tttcattatt       660
     gaaaatcggc tgaccaaacc agagcaactg actggtttta atagcgaagg ttacttcttt       720
     gatgaagctt cctccagcaa tggcgaactg gtgtttaaac gctacgagca gcgttaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page