(data stored in ACNUC7421 zone)

EMBL: BA000007.YAAJ

BA000007.YAAJ        Location/Qualifiers
FT   CDS_pept        complement(6546..7976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="ECs_0007"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33430"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33430"
FT                   /db_xref="GOA:Q8XA75"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA75"
FT                   /protein_id="BAB33430.1"
FT                   /translation="MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGK
FT                   SLKNSIHPQPGGLTSFQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMA
FT                   TSFAECSLAQLYKERDVNGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGVQA
FT                   NAVARALSFSFDFPPLVTGIILAVFALLAIIRGLHGVARLMQGFVPLMAIIWVLTSLVI
FT                   CVINIGQLPHVIWSIFESAFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAM
FT                   RVLMGSWGAEFVTLVVILFAFSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIG
FT                   GTLLSLPLMWQLADIIMACMAITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRY
FT                   PDIGRQLSRDAWDDVSQE"
     atgccagatt ttttctcctt tattaacagc gtcctttggg gatcggtaat gatttacctg        60
     ctcttcggcg caggttgttg gttcactttt cgcaccggat ttgtgcagtt tcgctacatc       120
     cgccagtttg gcaaaagtct taaaaatagc attcatccac agccaggcgg tttaacctca       180
     tttcagtcat tgtgtaccag tcttgcggcg cgcgtgggta gcggcaacct ggccggcgtt       240
     gcgctggcta ttaccgccgg tggacctgga gccgtctttt ggatgtgggt tgccgcgttt       300
     atcggcatgg cgacctcgtt tgccgaatgt tcccttgcac aactttataa agaacgtgac       360
     gtcaatgggc agtttcgtgg cggaccggca tggtatatgg cgcgcgggct ggggatgcgc       420
     tggatgggcg ttctgttcgc cgtctttttg ctcatcgcct acggcataat tttcagcgga       480
     gttcaggcaa acgctgttgc ccgagctctg agtttttctt ttgattttcc cccgctggtg       540
     acaggcatta ttcttgctgt ctttgctctg ctggcaatca ttcgcggtct tcatggcgtc       600
     gcccggctca tgcaggggtt tgtcccgttg atggcgataa tctgggtact gaccagcctg       660
     gtgatttgcg taataaatat cgggcaactt ccccacgtca tttggtctat ttttgagagt       720
     gcttttggct ggcaggaagc ggcaggcggc gcggcgggat ataccttaag ccaggcgatt       780
     actaacggtt ttcagcgcag tatgttttcc aatgaggcgg gaatggggtc gacgccaaac       840
     gcggcagcgg cagcggcgtc ctggcctccg catccggcag cgcaaggaat tgtccagatg       900
     attggcattt ttatcgacac cctggtcatc tgtacggcaa gcgccatgct gatattactg       960
     gcgggtaacg gcacaaccta catgccgctg gaaggtattc agcttatcca gaaggcgatg      1020
     cgggtgctaa tgggttcctg gggtgctgaa tttgttaccc tcgtggttat tctgtttgcc      1080
     ttcagctcca tcgttgccaa ctacatttat gccgaaaaca atctcttctt tttacgcctg      1140
     aacaacccta aagcgatctg gtgtttgcgg atctgcacct tcgcaacggt catcggcggc      1200
     accttgctaa gtcttccgct gatgtggcaa ctggcagata tcataatggc ctgcatggct      1260
     attaccaatt tgactgccat attactgctc tcgcctgtgg ttcataccat tgccagtgat      1320
     tatctacgcc agcgtaaact cggcgtgcgc ccggtgtttg atccgttgcg ttatccggat      1380
     atcggtcgcc agctttctcg ggacgcgtgg gatgatgttt cgcaggagta a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page