(data stored in ACNUC7421 zone)

EMBL: BA000007.YAAX

BA000007.YAAX        Location/Qualifiers
FT   CDS_pept        5251..5547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECs_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33428"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33428"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA78"
FT                   /protein_id="BAB33428.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMATQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR"
     gtgaaaaaga tgcaatctat cgtactcgca ctttccctgg ttctggtcgc tcccatggca        60
     acgcaggctg cggaaattac gttagtcccg tcagtaaaat tacagatagg cgatcgtgat       120
     aatcgcggtt attactggga tggcggtcac tggcgcgacc acggctggtg gaaacaacat       180
     tatgaatggc gaggcaatcg ctggcaccca cacggaccgc cgccaccgcc gcgtcaccat       240
     aagaaagctc atcatgatca tcacggcggt catggtccag gcaaacatca ccgctaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page