(data stored in ACNUC7421 zone)

EMBL: BA000007.YABI

BA000007.YABI        Location/Qualifiers
FT   CDS_pept        76198..76962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECs_0069"
FT                   /product="DedA family inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33492"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33492"
FT                   /db_xref="GOA:Q8XA07"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA07"
FT                   /protein_id="BAB33492.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLVRHPLMPVYIDILRKVVGV"
     atgcaagcat tgctggaaca ctttattacc caatccaccg tgtattcatt gatggcggtg        60
     gtgttggtgg cctttctgga gtcgctggcg ctggtcggtt tgattctacc cggtacggtg       120
     ctgatggcgg ggctgggagc gctgattggc agcggcgagt taagtttctg gcacgcctgg       180
     ctggcaggga tcgtcggttg tctgctgggc gactggatct ccttctggct gggctggcgt       240
     tttaaaaagc cattgcatcg ttggtcattt ctgaagaaga acaaagcatt actcgataaa       300
     actgaacatg cgttgcatca acacagcatg ttcaccattc tggtcggtcg ttttgttggc       360
     ccgacgcgtc cgctggtgcc aatggtggcg ggaatgctgg atctcccggt ggcaaaattt       420
     atcacgccga atattatcgg ctgcctgctg tggccaccgt tttacttcct gccggggatt       480
     ctggcgggtg cggcgatcga tattccagcc ggaatgcaga gcggtgagtt taaatggttg       540
     ctgctggcga cggcggtatt tttgtgggtt ggtggctggc tgtgctggcg gttatggcgc       600
     agcggcaaag caaccgatcg tttgagtcat tatttgtccc gcggtcgttt gttgtggctg       660
     acgccgttga tttctgccat cggcgtggtg gcgctggtgg tgttagttcg ccatccgtta       720
     atgccggtgt atatcgatat tttgcgtaaa gtggttggag tttag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page