(data stored in ACNUC7421 zone)

EMBL: BA000007.YACC

BA000007.YACC        Location/Qualifiers
FT   CDS_pept        complement(140943..141251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECs_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33549"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33549"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X949"
FT                   /protein_id="BAB33549.2"
FT                   /translation="MAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRA
FT                   LVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK"
     atggccgttt gcgcaaacag ttacgcgctc agtgagtctg aagccgaaga tatggccgat        60
     ttaacggcag tttttgtctt tctgaagaac gattgtggtt accagaactt acctaacggg       120
     caaattcgtc gcgcactggt ctttttcgcc cagcaaaacc agtgggatct cagtaattac       180
     gacaccttcg acatgaaagc tctcggtgaa gacagctacc gcgatctcag cggcattggc       240
     attcccgtcg ctaaaaagtg caaggccctg gctcgcgatt ccttaagcct gcttgcctac       300
     gtcaaataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page