(data stored in ACNUC7421 zone)

EMBL: BA000007.YACH

BA000007.YACH        Location/Qualifiers
FT   CDS_pept        complement(133780..135633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECs_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33544"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33544"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X959"
FT                   /protein_id="BAB33544.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVETQSTQL
FT                   AVSDAAAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKTVPVTQTVTAPVIPSNTVST
FT                   ANPVITEPATTVISIEPGNPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDNYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVHEKMQTNPQNQQRREAARERIQPASPEQRQAVREKMQTN
FT                   PQIQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KVQESRPQRLNDSNHTARLNNEQRSAVRERLSERGARRLER"
     atgaaaatga ctttgccgtt taaaccccat gtgctggcgc taatttgcag tgccgggctt        60
     tgtgccgcct ctgccgggct atatataaaa agccgcacag tggaagcgcc tgtggaaacg       120
     caatcgacac aactggctgt gtctgacgct gccgcagtta cgcttcctgc aacggtttcc       180
     gcacctcccg taacacccgc cgtcgtcaaa tccgcattca gcactgcaca aatagatcaa       240
     tgggtcgcgc ccgtcgcgct gtatcccgac gccctacttt cgcaggtgct gatggcatca       300
     acctatccga caaacgttgc tcaagcagtg caatggtcgc acgataatcc acttaaacaa       360
     ggcgatgctg ctattcaggc ggtatctgac cagccgtggg acgccagcgt taaatcactg       420
     gtggcctttc cacaattgat ggcattgatg ggcgaaaacc cgcaatgggt gcaaaacctg       480
     ggcgatgctt ttctggccca gccgcaggac gtgatggact cggtacaacg attgcggcaa       540
     ctggcacaac aaaccggctc gctgaagtca tcaaccgaac agaaagttat taccacaacg       600
     aagaaaactg taccggtaac acagacagtc acggctcccg tcataccatc caataccgtt       660
     tcaactgcca accctgtcat tacagagcct gcaacaaccg tcatttccat tgagcccggc       720
     aatcctgatg tggtctatat tcccaactac aacccaaccg tggtttacgg gaactgggcc       780
     aatactgcgt atccgccggt ttatctgcca ccaccagccg gagaaccgtt tgttgacagc       840
     tttgtacgcg gattcggcta tagcatgggc gttgctacca cgtacgcact attcagcagc       900
     atcgactggg atgacgacga tcatgaccat catcatcatg acgatgataa ttatcatcac       960
     cacgatggcg gtcatcgtga cggtaatggc tggcaacata acggcgacaa catcaatatc      1020
     gacgtcaaca atttcaaccg tatcaccggt gagcatctta ctgataagaa tatggcatgg      1080
     cggcacaatc caaactaccg taatggtgtg ccctatcatg atcaggatat ggcaaagcgg      1140
     tttcatcaaa ctgatgtcaa cggcggaatg agtgccacgc agctacctgc tccaacacgc      1200
     gacagccagc gtcaggcggc agcaagtcag tttcagcaac gaacacacgc cgcccccgtc      1260
     attacacgag atacccaacg tcaggcagcg gcacagcggt ttaatgaagc tgaacactat      1320
     gggagctatg acgacttccg cgacttcagc cgtcgccaac cactgaccca gcaacaaaag      1380
     gacgccgctc gtcagcgtta tcagtcagct tctcctgagc agcgccaggc agttcacgag      1440
     aaaatgcaga ctaacccgca gaaccagcag cgaagagagg cagcgcgtga gcgcattcag      1500
     cccgcctcgc ctgagcagcg ccaggcagtc cgcgagaaaa tgcagactaa cccacagatc      1560
     cagcagcgaa gagacgcagc gcgtgagcgt attcagtcag cctcgcctga gcagcgccag      1620
     gtgtttaagg aaaaagtaca gcagcgccca ctgaaccaac agcaacgtga taacgcccgc      1680
     cagcgtgttc aatcagcatc acctgaacaa cgtcaggttt ttcgggagaa agttcaggag      1740
     agccgcccac aacgtctaaa cgacagtaac catactgcca ggctgaataa cgagcaacgg      1800
     tcagcagtac gcgaacgtct ctctgagcgc ggagcaaggc gactggaaag gtaa            1854
//

If you have problems or comments...

PBIL Back to PBIL home page