(data stored in ACNUC7421 zone)

EMBL: BA000007.YACL

BA000007.YACL        Location/Qualifiers
FT   CDS_pept        138761..139123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="ECs_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33546"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33546"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8E6"
FT                   /protein_id="BAB33546.2"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
     atggattacg aatttctgcg cgatattacc ggagtggtaa aggtgcgtat gtccatgggg        60
     catgaagtgg tcgggcactg gtttaatgaa gaggtgaaag aaaacctggc cttgcttgat       120
     gaagtggaac aagcagcgca cgcactgaaa ggtagcgaac gttcctggca gcgggcaggg       180
     catgagtata cgctatggat ggacggcgaa gaggtgatgg ttcgcgccaa tcaactggaa       240
     ttcgctggcg atgaaatgga agaggggatg aactactacg acgaagaaag cctgtcgcta       300
     tgcggcgttg aggattttct gcaggtcgtg gcggcttacc gcaatttcgt gcagcagaag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page