(data stored in ACNUC7421 zone)

EMBL: BA000007.YADC

BA000007.YADC        Location/Qualifiers
FT   CDS_pept        complement(154328..155437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECs_0139"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33562"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33562"
FT                   /db_xref="GOA:Q8X928"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR017014"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X928"
FT                   /protein_id="BAB33562.1"
FT                   /translation="MQRKGNKLLIQLCSVILLFFTTSWYALANECYIERNAEGDYHMKI
FT                   SSTQLSLASQMVEVPTEIAEATWDVNIQLRGDAIGCKSLGDSKAVHFLNTADPSLISTY
FT                   TTTNGAALLKTTVPGIVYSVELLCLSCGAADELDLWLPAQSGADNFIPSTQTKWAYEYS
FT                   DQSWYLRFRLFITPEFKPKNGVSSGTTIAGKIASWYIGTNDQPWINFYIDNDSLKFFVD
FT                   EPTCATVALAQDQGNVSGNQVTLGNSYVSEVKNGLTREIPFSIRAEYCYASKITVKLKA
FT                   ANKPSDATLVGKTTGSASGVAVKVNSTYDNSKVLLKADGSNTVDYNFAAWSNNLLFLPF
FT                   TAQLVPDGSGNAVGVGTFSGNATFSFTYE"
     atgcaaagga aaggcaataa actgttgatt cagttatgca gtgtgatact gctatttttt        60
     accacatcct ggtatgcatt ggcgaatgaa tgttatatag agagaaatgc tgaaggggat       120
     tatcacatga agataagctc tactcagctt agtctggcgt cacaaatggt cgaggttccg       180
     acagaaatag ccgaagctac atgggatgta aatattcaac taagaggcga tgccataggg       240
     tgtaaatctc ttggggatag taaggcagtt cactttctta atacagctga cccaagttta       300
     atatccacgt acaccacaac gaatggcgca gcgttattaa aaacaactgt tccaggcatt       360
     gtgtattctg tcgagttatt atgccttagt tgtggtgccg cagatgaact tgatttatgg       420
     ctacctgcac aaagtggcgc agataacttc ataccaagca cccagacgaa atgggcctat       480
     gagtacagtg atcaaagttg gtatttacgt tttcgcttat tcataactcc tgaatttaaa       540
     cccaagaatg gtgtttccag cggaacaacg atagcaggaa agattgcgtc atggtatata       600
     ggtaccaatg accagccgtg gatcaacttt tacattgaca atgactcttt aaagtttttc       660
     gtcgatgaac cgacctgtgc aacagttgcc ctggcacaag atcagggcaa cgtcagtggc       720
     aatcaggtaa cgcttgggaa cagctatgtt tcggaagtga aaaatgggct tacgcgggaa       780
     atcccttttt ctatccgtgc tgaatactgt tatgccagta aaattacggt taagttgaaa       840
     gcggcaaata aacccagcga tgccacactg gtgggtaaaa cgactggctc ggcttcaggc       900
     gtggctgtaa aagtaaattc aacttatgac aatagcaaag tattgttaaa agcagatggt       960
     agcaacacgg ttgactacaa cttcgccgcc tggtcaaaca acctgctgtt tttacctttt      1020
     acggcgcagc tggtaccgga tggtagcggt aatgctgtcg gtgttggaac attttcaggt      1080
     aacgcgacct tctcctttac ctacgaataa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page