(data stored in ACNUC7421 zone)

EMBL: BA000007.YADD

BA000007.YADD        Location/Qualifiers
FT   CDS_pept        151341..152237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="ECs_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33559"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33559"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X932"
FT                   /protein_id="BAB33559.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSESQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGKSMMTLAQWFEEKGIEKGIQQGRQEERQEFAQRFLSKGMSRED
FT                   VAEMTNLSLAEIDRLIN"
     atggatgcac cgagtaccac accgcatgac gcggtattta aacaattttt aatgcatgcg        60
     gagacggctc gcgactttct ggagatacat ttgccagtgg aattacgcga actttgtgac       120
     ctcaacacgc ttcatttaga gtcggggagt ttcattgaag agagccttaa aggacacagc       180
     acggacgtgc tctattccgt gcaaatgcag ggcaatcccg gttatctgca tgttgtgatt       240
     gaacaccaaa gcaagccgga taagaaaatg gcctttcgca tgatgcgtta ttctatagcc       300
     gccatgcatc ggcatctgga ggcggatcac gacaaactac cgctggtagt gccgattctc       360
     ttttatcagg gcgaggccac accttatccg ctctcaatgt gctggtttga tatgttttac       420
     tcgccggagc tggcgcgacg cgtctataac agtcctttcc cgctggtgga tatcaccatc       480
     acaccggatg acgaaatcat gcaacatcgg cggattgcga ttctcgaact actgcaaaaa       540
     catattcgcc agcgcgactt aatgttattg ctggagcaac tggtcacgct gattgacgaa       600
     gggtacacta gcgaaagtca gttagttgcc atgcaaaact atatgctgca acgcggtcat       660
     actgaacaag cggatttgtt ttatggtgtg ctgagagaca gggaaacggg agggaagtct       720
     atgatgacgc tggcacagtg gtttgaagag aaagggattg agaaggggat tcagcaggga       780
     agacaggagg agaggcaaga attcgcccag cgttttctga gtaaagggat gtctcgggaa       840
     gacgttgcag agatgacaaa tttatctctt gctgagattg ataggctgat taactaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page