(data stored in ACNUC7421 zone)

EMBL: BA000007.YADI

BA000007.YADI        Location/Qualifiers
FT   CDS_pept        148950..149390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECs_0133"
FT                   /product="PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33556"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33556"
FT                   /db_xref="GOA:Q8X935"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X935"
FT                   /protein_id="BAB33556.1"
FT                   /translation="MLGWVITCHDDRAQEILDVLEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSIWHQQQKNPPFVLKHNLYEY"
     atgttaggtt gggtaattac ctgtcacgat gaccgggcgc aagagatact ggatgtgctg        60
     gagaaaaaac atggggcgct tcttcagtgc cgggccgtga atttctggcg cggattaagt       120
     tctaatatgc tcagccgcat gatgtgcgat gctctgcatg aagcggactc tggtgagggt       180
     gtcatcttct taaccgatat agccggagcg ccaccgtacc gcgtggcttc attattaagc       240
     cacaaacact cccgttgcga agtgatttct ggtgtcacgt taccgttaat tgaacagatg       300
     atggcttgcc gtgaaaccat gaccagttca gagtttcgcg agcgtattgt cgaactgggt       360
     gcgccggagg tgagtagtat ttggcaccag caacaaaaaa atccgccttt cgtcctcaaa       420
     cataatttgt atgagtatta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page