(data stored in ACNUC7421 zone)

EMBL: BA000007.YADK

BA000007.YADK        Location/Qualifiers
FT   CDS_pept        complement(155449..156039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="ECs_0140"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33563"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33563"
FT                   /db_xref="GOA:Q8X920"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X920"
FT                   /protein_id="BAB33563.1"
FT                   /translation="MLCRHHKIVHFLGLATALITPFAYSGQDVDLTAKIVPSTCQVEVS
FT                   NNGVVDLGTVTLDYFADNVTPTTDYAGGKTFNVNVVSCDNIQTTQSQMKLDFQPQAGSL
FT                   AQANNQIFSNEYEQQATGAKNVGIVIFSAQPNQQTFNVRGTDGSSTAIYSVAPGNAVPS
FT                   TWTFYSRMQRVNNALPPESGMVRSQVIVNVSYE"
     atgctatgca ggcatcataa aatcgtacac tttttagggc tggcaacagc ccttatcacg        60
     ccttttgcct attccggcca ggatgtggat ctcaccgcaa agatcgtgcc cagcacctgt       120
     caggttgaag tcagtaataa tggcgttgtc gatctcggca cagtgacgct ggactatttt       180
     gccgacaatg taaccccgac aacggattat gcgggtggca aaacgtttaa tgtgaatgtg       240
     gtctcttgcg ataacattca aacgacacag tcgcaaatga aattagattt tcagccgcag       300
     gcgggatcgc ttgcacaggc gaataatcaa atttttagta atgaatatga acagcaggct       360
     accggggcga aaaacgtcgg cattgtgatt ttttcggccc aaccgaatca gcagacattt       420
     aacgtgcgag gaacggatgg ttcctcaaca gcaatttatt cggtagcacc tggcaatgct       480
     gttccctcaa cctggacctt ttattcccgt atgcagcggg tgaataatgc ccttcctcct       540
     gaatcgggaa tggtgagaag ccaggttatt gttaacgtat cttacgaata a                591
//

If you have problems or comments...

PBIL Back to PBIL home page