(data stored in ACNUC7421 zone)

EMBL: BA000007.YADL

BA000007.YADL        Location/Qualifiers
FT   CDS_pept        complement(156060..156665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECs_0141"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33564"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33564"
FT                   /db_xref="GOA:Q8X919"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X919"
FT                   /protein_id="BAB33564.1"
FT                   /translation="MKLKVIATLIATVAVGVSFNSNFASASTTSASLTVNSNLTMGTCS
FT                   AQIMDNSNKVINEVVFGNVYISELGAKSKVQQFKIRFSNCSGLPQNSAQIVLAPNGISC
FT                   AGSQSSSAGFSNKFTDASAATRTAVEVWTTDTPESNGSTQFHCAQKIPVPVTLPADTTT
FT                   QPYDYPLSARMTVAEGRLVTDVRPGNFRSPTTFTITYQ"
     atgaaattaa aagtcatcgc tacactgatt gctactgttg ccgtgggtgt aagctttaac        60
     agcaattttg cttctgcgag tacaacgtcc gcttctttaa ccgtaaacag taacctgact       120
     atgggtacct gcagtgctca gataatggat aatagtaata aagtgatcaa tgaagtggtc       180
     tttggcaatg tttatatttc tgaactcggt gcaaaaagca aagtgcaaca gtttaaaatt       240
     cgctttagca attgctctgg ccttccccaa aacagcgccc aaatagtgct ggcacctaat       300
     ggtatatcct gtgctggttc tcaatcgtca tcggcgggtt tttctaacaa gtttactgac       360
     gctagcgcag caaccagaac ggctgtggaa gtatggacta cagatacacc ggaaagcaat       420
     ggcagtacgc aattccattg tgctcaaaag ataccagtgc ctgtgacgct tcccgccgac       480
     accacaactc agccttacga ttacccgtta agtgcacgga tgaccgttgc ggaaggtaga       540
     ttggtaaccg atgtaagacc gggtaatttc cgctctccca cgactttcac gatcacttat       600
     cagtaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page