(data stored in ACNUC7421 zone)

EMBL: BA000007.YADM

BA000007.YADM        Location/Qualifiers
FT   CDS_pept        complement(156680..157228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECs_0142"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33565"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33565"
FT                   /db_xref="GOA:Q8X918"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X918"
FT                   /protein_id="BAB33565.2"
FT                   /translation="MKRILLTSALIGLGLPAVGSATDLNVDFTATVLATTCTITIVEDG
FT                   GPAVTGSNDEYSLTIPDVGLDKVATAAPEAQANFKLKASDCSNGYSKIFTTLTGTTVSG
FT                   KLIVNEATSGAAGVGMGIKRRDTADSTFFTPNNTDKFEWSADEKASGVPLTVALRETTA
FT                   GAGRTGAFQAKATFNFTYE"
     atgaaaagga tactactaac atccgcgtta ataggcctgg gtttaccggc ggttggctct        60
     gcaacagatc ttaatgtcga ttttacggcc accgtattag ccaccacctg cacgataact       120
     atagtggaag atggtggtcc agcagtgacc ggtagtaacg atgaatacag cctgacaatt       180
     cctgatgttg gtctggataa agtcgctacc gctgcgcccg aagctcaggc caactttaaa       240
     ttaaaggcct ccgattgcag caatggttac tcaaagattt ttaccacact tacaggaaca       300
     acggtttccg gtaagttaat tgttaatgaa gcaacctctg gcgctgctgg ggtggggatg       360
     gggattaagc gtagagatac cgcagactcg actttcttca cacccaataa tactgacaaa       420
     tttgaatgga gcgccgatga gaaagccagc ggtgtgcctc tgaccgtagc actgcgcgaa       480
     acaacggcgg gagcaggacg caccggtgcg tttcaggcaa aagccacctt taacttcacc       540
     tacgaataa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page