(data stored in ACNUC7421 zone)

EMBL: BA000007.YADN

BA000007.YADN        Location/Qualifiers
FT   CDS_pept        complement(160696..161292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECs_0145"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33568"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33568"
FT                   /db_xref="GOA:A0A0H3JBS4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBS4"
FT                   /protein_id="BAB33568.1"
FT                   /translation="MKKALLAAALVMASGSALAVDGGHIDFNGMVQSGTCKVGVVDTGM
FT                   HSVTTDGVVTLDTANVTDTFAEVSATAVGLLPKEFMISVECDPGAPKNAELTMGSASYA
FT                   NTSGTLNNNMNITVNGIAPAQNVNIAVHNMKNKAGAAEIKQVHMNNSSEVQELTLDAEG
FT                   KGQYVFNASYVKAPNSPAVTAGHVTTNALYTVAYK"
     atgaaaaaag cacttctcgc agccgctctg gttatggctt ctggttccgc cctggctgta        60
     gatggtggtc atatcgactt taacggtatg gtacagtccg gtacctgtaa agtgggtgtg       120
     gtagatactg gtatgcatag cgttaccact gatggcgtgg ttaccctgga tactgcgaat       180
     gttactgata cttttgctga agttagcgca actgctgtcg gtttactgcc gaaagagttc       240
     atgatttctg ttgagtgtga tccaggtgct ccgaagaatg ctgagttaac tatgggttct       300
     gcaagttacg cgaacaccag cggtaccctg aataacaata tgaacatcac tgttaacggt       360
     attgcaccgg ctcagaacgt aaacattgca gttcataaca tgaaaaacaa agctggcgct       420
     gctgaaatta agcaggtcca tatgaacaac tcttctgaag ttcaggaact gacattagac       480
     gcagaaggta aaggccagta cgtatttaac gcatcttacg ttaaagcacc gaacagcccg       540
     gctgtaactg ctggtcatgt aaccactaac gcgctgtaca ccgttgctta taagtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page