(data stored in ACNUC7421 zone)

EMBL: BA000007.YAEQ

BA000007.YAEQ        Location/Qualifiers
FT   CDS_pept        217636..218094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECs_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33615"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33615"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W6"
FT                   /protein_id="BAB33615.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCAQFANLSVWYLDDEQLAKVSAFADRTMTL"
     atggcgctta aagcgacaat ttataaagcg acggttaatg tggccgatct cgaccgcaac        60
     cagtttctcg atgcctctct gacgctggcg cgccaccctt cagaaaccca ggagcgtatg       120
     atgctgcgcc tgctggcgtg gctgaaatat gctgatgaac gtctgcaatt tacccgtggt       180
     ttgtgtgccg atgatgagcc ggaagcgtgg ctgcgtaacg atcacctggg cattgatttg       240
     tggattgagc tggggctgcc ggatgagcga cgaattaaga aagcctgcac ccaggccgca       300
     gaagtggcgc tgtttaccta taatagtcgg gcggcgcaaa tctggtggca gcaaaatcag       360
     agcaaatgtg cgcagtttgc caatctttcc gtctggtatc tggacgacga gcagctggcg       420
     aaagtgagcg cctttgccga tcgtaccatg acgctgtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page