(data stored in ACNUC7421 zone)

EMBL: BA000007.YAFD

BA000007.YAFD        Location/Qualifiers
FT   CDS_pept        234473..235252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="ECs_0205"
FT                   /product="endo/exonuclease/phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33628"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33628"
FT                   /db_xref="GOA:P0A8U4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8U4"
FT                   /protein_id="BAB33628.2"
FT                   /translation="MRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIRILVWNIY
FT                   KQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLPQHPSGVM
FT                   TLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLGVDVYSKQ
FT                   LLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRRRAFGRPL
FT                   DFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
     atgcgctatg ttgccggaca acctgcggag aggatcttac cgccggggtc ttttgcgagc        60
     atcggccagg cattaccacc cggagaaccg ttaagtaccg aagagcgtat tcggatcctg       120
     gtgtggaaca tatacaaaca gcaacgcgct gaatggttgt cggtattaaa gaattacggc       180
     aaagacgcac atctggtgtt attgcaggaa gcgcaaacaa cgccagagtt ggtacagttt       240
     gcgactgcta actatcttgc cgccgatcag gtacccgctt tcgtgctgcc acaacatcct       300
     tctggcgtaa tgaccctttc ggcggcacat ccagtgtatt gctgcccgtt acgtgaacga       360
     gaacccattt tgcgtctggc gaagtcggca ctggtgacgg tctatccatt acctgacacc       420
     cgcctgttaa tggtggttaa tatacacgcc gtcaacttca gtctgggcgt ggatgtttat       480
     agtaagcagt tacttcctat tggtgatcag atagctcacc acagcggccc ggtcattatg       540
     gcgggagatt tcaatgcttg gagccgtaga aggatgaacg cgttatatcg ttttgcgcgg       600
     gaaatgtcgc tgcgtcaggt gcgttttacc gatgatcagc gccgtcgggc gtttggtcgc       660
     ccgctcgatt ttgttttcta ccgtggtctg aacgtcagcg aagcttctgt actggttacg       720
     cgcgcgtccg atcacaatcc gctactcgtt gaattcagtc ccggcaagcc tgataaataa       780
//

If you have problems or comments...

PBIL Back to PBIL home page