(data stored in ACNUC7421 zone)

EMBL: BA000007.YAFJ

BA000007.YAFJ        Location/Qualifiers
FT   CDS_pept        282295..283062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECs_0250"
FT                   /product="type 2 glutamine amidotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33673"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33673"
FT                   /db_xref="GOA:Q8X7R0"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R0"
FT                   /protein_id="BAB33673.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGKTDSEKAFCWLLYKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
     atgtgcgaat tgctcgggat gagcgccaac gtccctaccg atatttgctt tagtttcacc        60
     gggctggtgc agcgtggtgg tggaaccggg ccacataaag atggctgggg cattaccttt       120
     tacgaaggta aaggctgtcg cacatttaaa gatccacaac ccagctttaa ttcccccatt       180
     gccaaacttg ttcaggacta cccgataaaa tcctgttcgg ttgtggctca tattcgccag       240
     gcaaatcggg gcgaggtggc gttggaaaat actcacccgt ttacccgcga gttatgggga       300
     cgtaactgga cttatgccca taacggacaa ctgacgggct ataaatcact ggaaaccggc       360
     aacttccgcc cggtaggtaa aaccgacagc gaaaaagcct tttgctggct gctgtataaa       420
     ttaacgcagc gttatccgcg tacgccgggc aatatggcgg cggtatttaa atatatcgcc       480
     tcactggcgg atgaactgcg gcagaagggc gttttcaaca tgctgctttc ggatgggcgc       540
     tatgtaatgg cgtattgctc gaccaatctg cactggatca cccgccgcgc gccgtttggc       600
     gtggcaacgt tgctggatca ggatgtggaa atcgacttca gctcgcagac cacaccgaat       660
     gatgtggtca cggtgattgc gacacagccg ctgacgggca atgaaacctg gcaaaagatt       720
     atgccaggcg aatggcgctt attttgcctc ggggagcgtg tagtttga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page