(data stored in ACNUC7421 zone)

EMBL: BA000007.YAFK

BA000007.YAFK        Location/Qualifiers
FT   CDS_pept        complement(283033..283773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="ECs_0251"
FT                   /product="L,D-transpeptidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33674"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33674"
FT                   /db_xref="GOA:P0AAA0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA0"
FT                   /protein_id="BAB33674.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
     atgcgtaaaa tcgcattaat tcttgcgatg ttgttgatcc cgtgcgtttc gtttgccggt        60
     ttgctgggca gcagtagctc gaccacgcca gtgagcaaag agtataagca gcagttgatg       120
     ggatcccctg tctacatcca gatcttcaag gaagaacgta cgctcgatct ctacgtcaaa       180
     atgggcgagc aatatcaact gctcgacagc tataaaatct gtaaatattc cggcggctta       240
     gggccaaaac agcgtcaggg cgatttcaaa agcccggaag ggttttatag cgtccagcgt       300
     aatcagttaa aaccagacag ccgttactac aaagcgatta atattggttt ccccaatgcc       360
     tatgaccgtg cgcatggtta tgaagggaaa tacctgatga tccacggcga ttgtgtttcc       420
     atcggctgct acgcgatgac caatcagggc attgacgaga ttttccagtt cgttactggc       480
     gcactggtat ttggtcagcc gagcgtgcaa gtgagcattt acccgttccg catgaccgac       540
     gccaatatga agcgccataa atattccaac tttaaggact tctgggagca actgaagcca       600
     ggctacgact actttgagca aacccgtaag ccaccgaccg tttctgtggt caatggccgt       660
     tacgtggtca gcaagccgtt aagccacgaa gttgtgcaac cacaactggc atcaaactac       720
     acgctccccg aggcaaaata a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page