(data stored in ACNUC7421 zone)

EMBL: BA000007.YAGU

BA000007.YAGU        Location/Qualifiers
FT   CDS_pept        335400..336014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECs_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33740"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33740"
FT                   /db_xref="GOA:P0AAA2"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA2"
FT                   /protein_id="BAB33740.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
     atgaatatat ttgaacaaac tccaccgaac cgcagacgtt atggtcttgc tgcattcatt        60
     gggctgattg ctggcgttgt ttccgcattt gtgaagtggg gggctgaagt tccattgccg       120
     ccacgtagcc cggtggatat gtttaatgca gcgtgtggcc cggaatcatt aatcagggct       180
     gctgggcaaa ttgattgctc gcgtaatttt ctcaatcctc cgtatatttt tcttcgagac       240
     tggctggggc tgacagatcc caatgcggct gtttatacct ttgccgggca tgtctttaac       300
     tgggttggtg ttacgcacat tatcttttcg atagtgtttg ctgtcggtta ttgtgtggtc       360
     gcagaagtat ttccaaaaat taaactctgg cagggcttac tggcaggtgc tttagcccaa       420
     ctttttgttc atatgatttc attccctctc atgggactga caccacctct gtttgatctc       480
     ccgtggtatg agaatgtttc tgaaattttt ggacatttag tctggttctg gtccattgaa       540
     attattcgca gagatttacg aaacagaatt actcatgagc cagaccctga gatcccttta       600
     ggctcaaaca gataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page