(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHC

BA000007.YAHC        Location/Qualifiers
FT   CDS_pept        complement(386013..386315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="ECs_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33789"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33789"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B3"
FT                   /protein_id="BAB33789.1"
FT                   /translation="MVWAFFAALAAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWL
FT                   LSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRDGY"
     atggtgtggg cgtttttcgc cgcgctggct gccggttggc tggcctctgt aagtggactg        60
     tccgcgttct gggcgagcgt aattactacc gtacccttct cggcggtggt ggtctggcaa       120
     gggcgtttct ggttactgtc atttattccc ggtggctttc tcggcatgac gctgtttttt       180
     gccagcggga tgaactggac ggtgacgtta ctgggttttc tggcgggtaa ctgcgtgggg       240
     ataatttcag aatatggcgg acaaaaatta agcgaagcga cgactaaacg cgacgggtat       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page