(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHD

BA000007.YAHD        Location/Qualifiers
FT   CDS_pept        386778..387383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="ECs_0367"
FT                   /product="ankyrin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33790"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33790"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B2"
FT                   /protein_id="BAB33790.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNGDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
     atgagtataa aaaatctacc tgccgactat ttattggctg cacaacaggg tgatatcgat        60
     aaagtaaaaa cctgccttgc gctgggtgtc gatattaata cctgcgatcg tcaggggaaa       120
     acggcaatta cgctggcaag tttatatcag caatatgctt gcgttcaggc attaattgat       180
     gccggagcgg atattaataa gcaagatcat acctgtttaa atcctttttt aattagctgt       240
     ctgaacggtg atttaacgct gctacgaatt attttaccgg ctaaaccaga ccttaattgc       300
     gtcacccgtt ttggcggtgt cggcctgacg cctgcctgtg aaaaaggcca tttaagtatt       360
     gtaaaagagc ttttggcgca tacggaaatt aacgttaacc agaccaacca tgttggctgg       420
     acgccactac tggaagcgat tgtgcttaac gatggcggga ttaaacagca ggcgattgtg       480
     cagttattgc tggaacacgg tgccagcccg catctgaccg ataaatatgg caaaacgcca       540
     ctggaactgg cgcgggaacg gggctttgaa gagattgcgc agttactgat tgccgcaggt       600
     gcataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page