(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHE

BA000007.YAHE        Location/Qualifiers
FT   CDS_pept        387423..388286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECs_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33791"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33791"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B1"
FT                   /protein_id="BAB33791.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   RLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVIDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLALILFISGHPAGKYKEEFYLGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     gtgtgggcgc taactgcgga tgcggatttt ctggcgcagc gagggcaagg acaggttgaa        60
     caggtctttg ccagagcggt aaatatcgca ctcccggctc gccagcagtt gctgacgctg       120
     ctttgtgaag agtacgacaa tgcgccaaac agttgtcggt tggcactcac tcactttgat       180
     gatctgttcc ggcatggtga taaggttcag tttgacgatc aaggtattac ggttggtcaa       240
     catcttcata tagagatgag tcgttgtcgg cgttggctgt ccccaacctt gcaaatgacc       300
     gctgtgaatt ttcgccttat cgcctggcaa cagtggcacg acatcattca tcagcacctg       360
     ggggaaaatg aaaccctgtt taattatcgc ggcgataatc cgttttatca ggcgttaaat       420
     aaagaattac atattaaacg acgggcagtt atacaggcag taatcgataa acaaaatatc       480
     gcctcagcgg tcgccagtat gatgggctta gggattggcc ttacgccatc agccgatgat       540
     tatttaacag gtctggcact tattttattt atttccgggc atccggcggg aaaatacaaa       600
     gaggaatttt atctcggctt gcaacgcggc agaaataata ccacgttatt aagtgccata       660
     acgctggaag ccgcattaca acaacgctgc cgggaaaata ttcatcgttt tattcacaac       720
     attatttatg acatccctgg gaacgcaact caggcaatag aaaaaattaa acatattggc       780
     tccagttccg gctgcgacat gctgtatggc atggccgatg gttgtgcgct gagccaaacc       840
     tacggaggga attatgtcag ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page