(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHG

BA000007.YAHG        Location/Qualifiers
FT   CDS_pept        389823..391241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECs_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33793"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33793"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A9"
FT                   /protein_id="BAB33793.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQFDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVAQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAVDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
     atgagccagt cactgtttag ccaaccattg aacgttatta acgtcggcat cgccatgttt        60
     agcgatgacc tgaaaaagca gcatgtagaa gtgactcaat tcgactggac gccgccgggg       120
     cagggcaata tgcaggtggt gcaggcgctg gataacattg ccgattcgcc gctggcagac       180
     aaaatcgccg ccgctaacca gcaggcgctg gagcgcatta tccagtcgca tccggtgctg       240
     attggttttg atcaggcgat taacgtggtg ccgggcatga cgccgaaaac cattcttcac       300
     gccgggccgc cgatcacctg ggaaaaaatg tgcggcgcga tgaaaggcgc ggtcaccgga       360
     gcgctggtgt tcgaaggact ggcgaaagat ctcgacgagg cggctgaact ggcggcttcc       420
     ggggagatca ccttctcgcc gtgtcacgag cacgactgcg tgggatcgat ggcgggtgtg       480
     acctcggcct cgatgtttat gcacatcgta aaaaacaaaa cctacggcaa catcgcttat       540
     accaacatga gcgagcagat ggcgaagatt ttgcgtatgg gcgctaacga ccagagcgtg       600
     attgaccgcc tgaactggat gcgtgatgtg cagggaccaa tactgcgcga cgcgatgaaa       660
     attatcggcg aaatcgatct gcgcttaatg ctggcgcagg cgctgcatat gggcgatgag       720
     tgccataacc gcaataacgc cgggacgacg ctgctgattc aggcgctgac gccggggatt       780
     atccaggcgg gctattccgt cgcgcaacag cgcgaagtgt ttgagtttgt tgccagtagc       840
     gattacttct ccggcccgac gtggatggcg atgtgtaaag cggcgatgga tgcggcgcac       900
     ggcatcgaat acagcaccgt cgttaccacc atggcgcgta acggcgtcga gttcggcctg       960
     cgggtgagcg gcctgccggg gcagtggttt accggcccag cgcagcaggt catcggcccg      1020
     atgtttgctg gttataagcc ggaagattcg gggctggata tcggcgacag cgccatcaca      1080
     gaaacctacg gtattggcgg gtttgccatg gcgaccgcgc ctgcaatcgt cgcgctggtg      1140
     gggggcacgg tggaagaggc tatcgatttc tcccgtcaga tgcgcgaaat cacccttggc      1200
     gaaaacccca acgtcaccat tccgctgctc ggttttatgg gcgtgccgtc ggcagtcgac      1260
     atcacccgcg tgggtagcag cggcattctg ccggtgatca acaccgccat cgcccataaa      1320
     gatgcgggcg tcggcatgat tggcgcgggc attgtgcatc caccattcgc ctgcttcgag      1380
     aaagccattc ttggctggtg cgaacgttac ggcgtttga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page