(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHI

BA000007.YAHI        Location/Qualifiers
FT   CDS_pept        391756..392706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECs_0372"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33795"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33795"
FT                   /db_xref="GOA:Q8X6A8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A8"
FT                   /protein_id="BAB33795.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPEKQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
     atgaaagaac ttgtggtcgt tgccattggt ggcaacagca ttatcaaaga taacgccagc        60
     cagtcgattg agcatcaggc ggaggcggtg aaagccgtgg ccgatacggt gctggaaatg       120
     ctggcttccg attacgacat tgtgctgacc cacggtaacg ggccgcaggt cgggctggat       180
     ttacgccgtg cggagattgc ccacgagcgc gaagggctgc ccttaacgcc gctggcgaac       240
     tgtgtggcag atacgcaggg cggcattggc tacctgatcc aacaggcgct gaacaaccgg       300
     ctggcgcgtc acggcgagaa aaaagccgtc accgtggtga ctcaggtgga agtggataaa       360
     aacgatccag gttttgccca tcccaccaag cccattggtg cattcttcag tgaaagccag       420
     cgtgacgaat tacaaaaggc aaaccctgac tggcgttttg ttgaagatgc tggacggggc       480
     tatcgccgcg tggtcgcctc gccggaaccg aaacgtattg tcgaagcacc cgccattaag       540
     gcgctgatcc aacaaggctt tgtggtgatt ggcgcgggcg gcggcggaat tcctgtggtg       600
     cgtactgacg cgggagatta ccaaagcgtg gacgcggtta tcgacaaaga tctctctacc       660
     gcgctgctgg cccgtgaaat tcacgccgac attctggtga tcaccaccgg cgtcgaaaaa       720
     gtctgtatcc actttggtaa acccgagaag caggcgctgg atcgggtgga tattgccacc       780
     atgactcgct atatgcagga aggacatttc ccgcccggca gcatgttgcc aaaaatcatc       840
     gccagcctga cgttcctgga acagggcggt aaagaagtga ttatcaccac gccggaatgc       900
     ctgccagcgg cgctgcgcgg tgaaacgggc acccacatta ttaaaacgta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page