(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHJ

BA000007.YAHJ        Location/Qualifiers
FT   CDS_pept        392716..394098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECs_0373"
FT                   /product="metallo-dependent hydrolase domain deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33796"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33796"
FT                   /db_xref="GOA:Q8X6A7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A7"
FT                   /protein_id="BAB33796.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGTSVPLAHAAVSGTTNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQNGKIVALRENKQHPDATLP
FT                   HYDAGDKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   SGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMAAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
     atgaaagaaa ataatagccg ccgtgaattt ctgagccaga gcggtaagat ggtcaccgcc        60
     gccgcgctgt ttggtacctc tgtgccgctc gcccatgcgg cggtctctgg caccacaaac       120
     tgcgaagcga acaacaccat gaaaatcact gacccgcatt actatctcga caacgtgctg       180
     ctggaaaccg gttttgacta cgaaaatggc gtggcggtgc agacccgcac ggcgcgccag       240
     accgtggaga ttcagaacgg caaaattgtc gcgctgcgcg agaataagca gcacccggat       300
     gccacgctgc cgcactatga cgctggcgat aagctgatgc tgcccaccac ccgcgacatg       360
     catattcatc tcgacaaaac gttttacggc gggccgtggc gctcgctcaa tcgcccggca       420
     ggcaccacca tccaggacat gatcaaactc gagcagaaaa tgctgccgga gctgcaaccg       480
     tacactcagg agcgggcaga aaaactgatt gatttattgc agtcgaaagg caccaccatt       540
     gcccgcagcc actgcaatat cgaaccggtt tccggcctga aaaatctgca aaatttgcag       600
     gcggtgctgg cgcgacgtca ggcgggcttt gagtgtgaaa tcgtcgcctt cccgcagcac       660
     ggtttgctgc tgtcgaaatc ggaaccctta atgcgtgaag caatgcaggc gggtgcgcat       720
     tacgtcggcg ggctggaccc gaccagtgtc gatggcgcga tggaaaaatc cctcgacacc       780
     atgttccaga ttgcgctgga ctacgacaaa ggcgtcgata ttcacctgca cgaaaccact       840
     ccgtcgggcg tggcagccat caattatatg gttgaaacgg tagagaaaac gcctcaactg       900
     aaaggtaagc tgaccatcag ccacgccttt gcgctggcta cgctcaacga gcaacaggta       960
     gatgaactgg cgcatcgcat ggcggcgcag caaatttcta tcgcctcgac ggtgccgatt      1020
     ggcacgctgc atatgccgct caaacagttg cacgacaaag gcgtaaaagt gatgactggc      1080
     actgacagcg ttatcgacca ctggtcgcct tatggtctgg gcgacatgct ggaaaaagcc      1140
     aatctctacg cgcagctcta tattcgtcct aacgaacaga acctctcccg ttcgctgttt      1200
     ctagccactg gcgatgtatt gccgctgaat gaaaaaggcg agcgtgtatg gccaaaagcg      1260
     caggatgacg ccagctttgt gctggtggac gcctcctgtt ccgccgaggc ggtggcgcgt      1320
     atctcgccga gaaccgcaac gttccataaa gggcaactgg tgtgggggag tgtggcaggt      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page