(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHO

BA000007.YAHO        Location/Qualifiers
FT   CDS_pept        403184..403459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="ECs_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33806"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33806"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X699"
FT                   /protein_id="BAB33806.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTADIYKKK"
     atgaaaataa tctctaaaat gttagtcggt gcgttagcgt ttgccgttac caatgtctat        60
     gccgctgaat tgatgaccaa agcggaattt gaaaaagttg aatcgcagta tgaaaaaata       120
     ggtgatattt caaccagtaa tgaaatgtcg actgcagatg caaaagaaga tttaatcaaa       180
     aaagccgatg aaaaaggggc tgatgtgttg gtactgacct ccggtcaaac tgacaataag       240
     atccacggca cggcggatat ttataagaag aagtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page