(data stored in ACNUC7421 zone)

EMBL: BA000007.YAII

BA000007.YAII        Location/Qualifiers
FT   CDS_pept        465544..466002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="ECs_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33859"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33859"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEB1"
FT                   /protein_id="BAB33859.2"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG"
     atgacaattt gggtggatgc cgacgcgtgt cccaatgtaa ttaaagagat tttgtatcgc        60
     gcggcggaac gtatgcagat gccgctggta ctggtagcaa accagagttt acgcgtgccg       120
     ccatcgcgat ttattcgtac gctgcgcgtc gcggcaggtt tcgacgttgc cgataacgaa       180
     attgtccggc agtgtgaagc gggagatttg gtgatcaccg cagatatacc tttggctgct       240
     gaagccatcg agaaaggcgc tgcggcgctt aatccgcgcg gtgaacgtta cacgccagcg       300
     accattcgtg agcgcctgac gatgcgcgat tttatggata ccttacgtgc cagtgggatc       360
     cagaccggcg gaccagatag cctttcacaa cgtgaccgcc aggcctttgc cgcggagctg       420
     gagaagtggt ggctggaagt gcaacgtagt cgtggctaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page