(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIL

BA000007.YAIL        Location/Qualifiers
FT   CDS_pept        434971..435510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECs_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33832"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33832"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J6"
FT                   /protein_id="BAB33832.2"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDNPYADFKVPDDLMW"
     atggcaaaac ttaccttaca agagcagttg ctcaaagcag gattagtcac cagcaaaaaa        60
     gcggcgaagg tcgagagaac ggcgaaaaaa tcgcgcgttc aggcgcgtga agctcgggcg       120
     gcggtagaag aaaataaaaa ggcacagctt gagcgtgata aacagcttag cgaacagcaa       180
     aaacaagcgg cgttggcgaa agaatataaa gctcaggtga agcagcttat tgaaatgaac       240
     cggatcacca ttgccaatgg cgatattggt tttaacttca ctgatggcaa tctgattaag       300
     aagatttttg tcgataagct cacacaggcg cagttgatta atggtcgtct ggcgattgcc       360
     cgcttgttgg tcgataacaa tagcgaaggt gaatacgcca ttattcccgc cagcgttgcc       420
     gataaaattg ctcagcgtga tgccagcagt attgtgttgc acagcgcgct cagtgccgaa       480
     gagcaggatg aagacaaccc gtatgccgac ttcaaagtgc ctgatgattt gatgtggtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page