(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIT

BA000007.YAIT        Location/Qualifiers
FT   CDS_pept        451256..454198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiT"
FT                   /locus_tag="ECs_0424"
FT                   /product="flagellin structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33847"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33847"
FT                   /db_xref="GOA:A0A0H3JCC1"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCC1"
FT                   /protein_id="BAB33847.1"
FT                   /translation="MHSWKKKLIVSQLALACTLAITSQANAATNDISGQTYNTFHHYND
FT                   ATYADDVYYDGYVGWNNYAADSYYNGDIYPVINNATVNGVISTYYLDDGISTNTNANSL
FT                   TIKNSTIHGMITSECMTTDCADDRATGYVYDRLTLSVDNSTIDDNYEHYTYNGTYNNAA
FT                   DTHVVDVYDMGTAITLDQEVDLSITNNSHVAGITLTQGYEWEDIDDNTVSTGVNSSEVF
FT                   NNTITVKDSTVTSGSWTDEGTTGWFGHTGNASNYSNTLTADDVAIAAIANPYADNAMQT
FT                   TVTLDNSTLMGDVVFSSNFDENFFPQGANSYRDADGDVDTNGWDGTDRMDVTLNNGSKW
FT                   VGAAMSVHMVDEDGDGSYDGYAVGTEATATLLDIAANSLWPSSTVGVDNINTQYDENGH
FT                   IVGNEVYQSGLFNVTLNGGSEWDTTKSSLIDTLSINSGSQVNVADSRLISDTVSLTGGS
FT                   NLNIGEDGHVATNTLTIDNSTVKMSDDVSAGWGLEDAALYANTITVTNDGLLDINVDQF
FT                   DANPFQADTLNLTSTTDTNGNIHAGVFDIHSSDYVMDTDLVNDRTNDTTKSNYGYGLIA
FT                   MNSDGHLTINGNGDNDNTASIEAGQNEVDNNGDHVAAATGNYKVRIDNATGAGSIADYN
FT                   GNELIYVNDKNSNATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSAN
FT                   TNIWNLEQDTVGTRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDT
FT                   KIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHF
FT                   NNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSISGLFQSGDDYQL
FT                   SNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSID
FT                   NGTEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
     atgcactcct ggaaaaagaa acttatagta tcacaattag cattggcttg cactctggct        60
     atcacctctc aggctaatgc agcgaccaac gatatttctg gtcaaactta caatactttc       120
     catcactaca acgacgccac ctatgctgat gacgtttact atgatggtta tgtaggctgg       180
     aacaactatg ccgctgatag ctattacaac ggcgatatct acccggtcat taataacgct       240
     accgttaacg gcgtgatttc tacctactat ctggacgacg gtatttctac caataccaac       300
     gccaatagtc tgacaatcaa aaacagcact attcacggta tgattacctc tgagtgcatg       360
     actactgatt gtgctgatga ccgtgctact ggttatgttt atgatcgtct gacactgagc       420
     gttgataatt caacgatcga tgacaactac gagcattata cttacaacgg tacctataat       480
     aatgccgctg acactcatgt tgtagatgtt tacgatatgg gtactgctat tacactggat       540
     caggaagttg atctgtccat cactaataac tctcatgtag caggtattac gctgactcag       600
     ggttatgagt gggaagatat tgacgacaac acagtcagca ctggcgtaaa cagcagcgaa       660
     gtgtttaata acactattac tgttaaagat tctactgtga cctctggttc atggactgat       720
     gaaggtacta ctggttggtt tggccatact ggtaatgcca gcaactatag caacacgctg       780
     actgcagacg atgttgcaat tgccgcaatc gcaaatccgt atgctgataa tgcgatgcag       840
     actacagtaa ctttagacaa ctcaacactg atgggtgatg ttgttttctc cagtaatttc       900
     gatgaaaact tcttcccgca aggtgctaac agctatcgcg atgctgatgg tgatgtagat       960
     accaacggtt gggatggcac agaccgtatg gatgtgactc tgaacaacgg cagcaagtgg      1020
     gttggcgctg caatgtctgt tcatatggtt gatgaagatg gtgatggttc ttacgacgga      1080
     tatgctgttg gtactgaagc aactgcaact ctgctcgata ttgcagctaa cagcctgtgg      1140
     ccttcatcaa ctgtcggtgt tgataacatc aatactcaat atgacgaaaa tggccatatc      1200
     gtaggaaacg aagtttacca gagcggtttg tttaatgtga ctttgaacgg tggttcagag      1260
     tgggatacaa caaaatcttc tctgattgat actttaagta ttaacagcgg ttcccaagtt      1320
     aatgttgcag actctcgtct gatctctgac actgtctctc tgactggcgg ttctaacctg      1380
     aacatcggtg aagacggtca tgtagcgact aataccctga ccatcgacaa tagtaccgtt      1440
     aaaatgtctg atgatgtttc tgcgggctgg ggtttagaag atgctgcact gtacgcaaat      1500
     accatcaccg taactaacga cggtctgttg gatattaacg ttgatcagtt cgatgctaac      1560
     ccgttccagg ccgataccct gaatctgacc agtaccactg atactaacgg caacattcac      1620
     gctggtgtat tcgatatcca tagcagtgat tacgtaatgg ataccgatct ggtcaacgat      1680
     cgtaccaacg atactaccaa gtcaaactac ggttatggct taatcgcaat gaactctgat      1740
     ggtcacctga ctattaacgg taacggcgat aacgacaaca ctgcttctat cgaagctggt      1800
     cagaacgaag ttgataacaa cggtgaccat gttgcagccg cgaccggtaa ctacaaagtt      1860
     cgtatcgaca acgctactgg tgctggttct atcgctgact acaacggcaa cgagctgatc      1920
     tacgtcaacg acaaaaacag caacgcgacc ttctctgctg ctaacaaagc tgacctgggt      1980
     gcatacacct atcaggctga acagcgcggt aacaccgttg ttctgcaaca gatggagttg      2040
     accgactacg ctaacatggc gctgagcatc ccatctgcga acaccaatat ctggaacctg      2100
     gaacaagaca ccgttggtac tcgtttgacc aactctcgtc atggcctggc tgataacggc      2160
     ggcgcatggg taagctactt cggtggtaac ttcaacggcg acaacggcac catcaactat      2220
     gatcaggatg ttaacggcat catggtcggt gttgatacca aaattgacgg taacaacgct      2280
     aagtggatcg tcggtgcggc tgcaggcttc gctaaaggtg acatgaatga ccgttctggt      2340
     caggtggatc aagacagcca gactgcctac atctactctt ctgctcactt cgcgaacaac      2400
     gtctttgttg atggtagctt gagctactct cacttcaaca acgacctgtc tgcaaccatg      2460
     agcaacggta cttacgttga cggtagcacc aactccgacg cttggggctt cggtttgaaa      2520
     gccggttacg acttcaaact gggtgatgct ggttacgtga ctccttacgg cagcatttct      2580
     ggtctgttcc agtctggtga tgactaccag ctgagcaacg acatgaaagt tgacggtcag      2640
     tcttacgaca gcatgcgtta tgaactgggt gtagatgcag gttatacctt cacctacagc      2700
     gaagatcagg ctctgactcc gtacttcaaa ctggcttacg tctacgacga ctctaacaac      2760
     gataacgatg tgaacggtga ttccatcgat aacggtactg aagggtctgc ggtacgtgtt      2820
     ggtctgggta ctcagttcag cttcaccaag aacttcagcg cctataccga tgctaactac      2880
     ctcggtggtg gtgacgtaga tcaagactgg tccgcgaacg tgggtgttaa atatacctgg      2940
     taa                                                                    2943
//

If you have problems or comments...

PBIL Back to PBIL home page