(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIW

BA000007.YAIW        Location/Qualifiers
FT   CDS_pept        457652..458746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECs_0428"
FT                   /product="microcin Bac7 uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33851"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33851"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5H6"
FT                   /protein_id="BAB33851.1"
FT                   /translation="MSRVNHLSSLSFLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSGIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAAKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
     atgtcgcgag tcaatcatct gtcttcgctt tcatttttgg cggttctggt tttagcgggg        60
     tgtagcagtc aggcgccaca gccgttgaaa aagggcgaaa aagcgataga tgtggctagc       120
     gtggtgcggc agaagatgcc tgcgagcgtg aaagaccgcg atgcctgggc gaaagatctc       180
     gccaccacct ttgaaagtca ggggctggca ccgacgctgg aaaacgtctg ctcggtgctg       240
     gcggtggcgc agcaggagtc aaattatcag gcagatccgg ccgttccggg cttaagcaag       300
     atcgcctggc aagagattga ccgtcgtgct gaacggatgc acattcctgc ttttctggtt       360
     catactgcgc taaaaatcaa atcgccaaac ggcaaaagtt atagcgaacg gttagattcg       420
     gtgcgtacag aaaagcaatt gagcgggatt tttgacgatc tgatcagcat ggtgccaatg       480
     gggcagacgt tgtttggttc gcttaatccg gtgcgcaccg gtgggccgat gcaggtcagc       540
     attgcttttg ccgaacagca taccaaaggg tatccgtgga aaatggacgg tacagtccgt       600
     caggaagtct ttagtcgccg cggcgggttg tggtttggta cttaccattt actgaattat       660
     cccgccagtt atagcgcacc gatataccgt tttgctgatt ttaacgctgg ctggtacgcc       720
     agccgtaatg ccgcgtttca gaacgcggtc agtaaggcca gcggcgtgaa gctggcactg       780
     gacggtgatt taattcgtta cgacagtaaa gaacccggga aaaccgaact ggcaacgcgc       840
     aaactggcgg caaaactggg gatgagcgac agcgaaattc gtcgtcagct agagaaaggt       900
     gacagcttct cttttgagga gacggcgctg tacaagaaag tttatcaact tgccgaagcg       960
     aaaacgggta aatcactccc ccgcgaaatg ttgcctggca ttcaactgga aagcccgaaa      1020
     atcacccgca acctgactac ggcctggttt gcgaagcgcg tagacgaacg gcgggcgcgt      1080
     tgtatgaaac agtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page