(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIY

BA000007.YAIY        Location/Qualifiers
FT   CDS_pept        complement(458805..459113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="ECs_0429"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33852"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33852"
FT                   /db_xref="GOA:P0AAP9"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP9"
FT                   /protein_id="BAB33852.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
     atggctgatt tcaccctgtc aaaatcgctg tttagcggaa aatatcgcaa tgcctcttca        60
     acgcctggca acattgccta tgcgttgttt gtgctgtttt gcttttgggc tggggcgcaa       120
     ttgctgaacc tgttagtgca tgcgcccggc gtctatgagc gtttaatgca ggtccaggaa       180
     acaggtcgcc cacgggtgga aattggttta ggtgtcggca ccattttcgg gctgatcccg       240
     tttttagtag gctgcctcat ttttgcagtg gtggcgctat ggctgcactg gcgacatcgc       300
     cgccagtaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page